(data stored in SCRATCH zone)

EMBL: AL161565.AT4G26780

AL161565.AT4G26780   Location/Qualifiers
FT   CDS             complement(join(182241..182339,182435..182563,
FT                   182643..182810,182895..183338,183640..183735))
FT                   /gene="AT4g26780"
FT                   /product="grpE like protein"
FT                   /note="gDNA differs from cDNA AR192 (PID:g1669597) at two
FT                   positions but gDNAwas confirmed with a 10 fold coverage"
FT                   /note="nearly identical to cDNA AR192, that complements
FT                   pheromone receptorent mutant of Sizosaccharomyces pombe"
FT                   /note="Contains grpE protein signature AA253-296"
FT                   /note="contains EST gb:AI996540.1"
FT                   /db_xref="GOA:Q8LB47"
FT                   /db_xref="InterPro:IPR000740"
FT                   /db_xref="InterPro:IPR009012"
FT                   /db_xref="InterPro:IPR013805"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8LB47"
FT                   /protein_id="CAB79533.1"
FT                   /translation="MLVLRILSRVTRNAGIRSSLSAVTLPARNQTPLVPAQMSMMDSFA
FT                   LQRFNFSSSTSPESDEKKTHTEASKTSEEKPTAEANQPGLDSESKDSVTDSAKRKRKGA
FT                   KGAASSSSESDSESDDDELSADDLVKLVAEKEELLSEKEEEIKQLKDKVLRTYAEMENV
FT                   MDRTRRDAENTKKYAVQNFAKSLLDVADNLGRASSVVKESFSKLDTSEDSAGAAPLLKT
FT                   LLEGVEMTEKQLAEVFKKFGMEKYDPINEPFDPNRHNAVFQVPDASKPEGTVAHVLKSG
FT                   YTLYDRVIRPAEVGVTQGGENQEEKKESDA"
     MLVLRILSRV TRNAGIRSSL SAVTLPARNQ TPLVPAQMSM MDSFALQRFN FSSSTSPESD        60
     EKKTHTEASK TSEEKPTAEA NQPGLDSESK DSVTDSAKRK RKGAKGAASS SSESDSESDD       120
     DELSADDLVK LVAEKEELLS EKEEEIKQLK DKVLRTYAEM ENVMDRTRRD AENTKKYAVQ       180
     NFAKSLLDVA DNLGRASSVV KESFSKLDTS EDSAGAAPLL KTLLEGVEMT EKQLAEVFKK       240
     FGMEKYDPIN EPFDPNRHNA VFQVPDASKP EGTVAHVLKS GYTLYDRVIR PAEVGVTQGG       300
     ENQEEKKESD A                                                            311
//

If you have problems or comments...

PBIL Back to PBIL home page