(data stored in SCRATCH zone)

EMBL: AL161565.AT4G26790

AL161565.AT4G26790   Location/Qualifiers
FT   CDS             join(185034..185405,185466..185997,186131..186324)
FT                   /gene="AT4g26790"
FT                   /product="putative APG protein"
FT                   /note="similarity to proline-rich protein APG - Arabidopsis
FT                   thaliana, EMBL:X60377"
FT                   /note="Contains Aminotransferases class-V
FT                   pyridoxal-phosphate attachment site AA216-234"
FT                   /note="contains EST gb:T04213, T46442, T42101, AI992441.1,
FT                   H36224, H77179, T42929, N97259"
FT                   /db_xref="GOA:Q8VY93"
FT                   /db_xref="InterPro:IPR001087"
FT                   /db_xref="InterPro:IPR035669"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8VY93"
FT                   /protein_id="CAB79534.1"
FT                   /translation="MQRNRVLAFLLLAAQLLVKIPETCAKFPALIVFGDSTVDSGNNNQ
FT                   ISTVLKSNFQPYGRDYFDGKATGRFSNGRIAPDFISEGLGLKNAVPAYLDPAYNIADFA
FT                   TGVCFASAGTGLDNATSAVLISDMLSLNCHRFLKSVMPLWKEVEYYKEYQTRLRSYLGE
FT                   EKANEIISESLYLISIGTNDFLENYYLLPRKLRKYSVNEYQYFLIGIAADFVTDIYRLG
FT                   ARKMSLSGLSPFGCLPLERTTQLFYGSKCIEEYNIVARDFNIKMEEKVFQLNRDLNGIQ
FT                   LVFSNPYDLVSEIIYHPEAFGFENVRSACCGTGYYEMSYLCDKMNPFTCSDASKYVFWD
FT                   SFHPTEKTNAIVANHVLKYDLSRFQ"
     MQRNRVLAFL LLAAQLLVKI PETCAKFPAL IVFGDSTVDS GNNNQISTVL KSNFQPYGRD        60
     YFDGKATGRF SNGRIAPDFI SEGLGLKNAV PAYLDPAYNI ADFATGVCFA SAGTGLDNAT       120
     SAVLISDMLS LNCHRFLKSV MPLWKEVEYY KEYQTRLRSY LGEEKANEII SESLYLISIG       180
     TNDFLENYYL LPRKLRKYSV NEYQYFLIGI AADFVTDIYR LGARKMSLSG LSPFGCLPLE       240
     RTTQLFYGSK CIEEYNIVAR DFNIKMEEKV FQLNRDLNGI QLVFSNPYDL VSEIIYHPEA       300
     FGFENVRSAC CGTGYYEMSY LCDKMNPFTC SDASKYVFWD SFHPTEKTNA IVANHVLKYD       360
     LSRFQ                                                                   365
//

If you have problems or comments...

PBIL Back to PBIL home page