(data stored in SCRATCH zone)

EMBL: AL161565.AT4G26800

AL161565.AT4G26800   Location/Qualifiers
FT   CDS             187314..188633
FT                   /gene="AT4g26800"
FT                   /product="putative protein"
FT                   /note="similarity to other Arabidopsis putative proteins"
FT                   /note="contains EST gb:AA728420"
FT                   /db_xref="InterPro:IPR002885"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9SZ20"
FT                   /protein_id="CAB79535.1"
FT                   /translation="MAYSYPLPSIVEFNKVLTAIAKMQMYDVVINLWKRIENAEGIEIS
FT                   PDLYTCNILVNCFCRCFQPSSALSYLGKMMKLGIEPDIVTASSLVNGFCLSNSIKDAVY
FT                   VAGQMEKMGIKRDVVVDTILIDTLCKNRLVVPALEVLKRMKDRGISPNVVTYSSLITGL
FT                   CKSGRLADAERRLHEMDSKKINPNVITFSALIDAYAKRGKLSKVDSVYKMMIQMSIDPN
FT                   VFTYSSLIYGLCMHNRVDEAIKMLDLMISKGCTPNVVTYSTLANGFFKSSRVDDGIKLL
FT                   DDMPQRGVAANTVSCNTLIKGYFQAGKIDLALGVFGYMTSNGLIPNIRSYNIVLAGLFA
FT                   NGEVEKALSRFEHMQKTRNDLDIITYTIMIHGMCKACMVKEAYDLFYKLKFKRVEPDFK
FT                   AYTIMIAELNRAGMRTEADALNRFYQKHVRQNESAPAEVS"
     MAYSYPLPSI VEFNKVLTAI AKMQMYDVVI NLWKRIENAE GIEISPDLYT CNILVNCFCR        60
     CFQPSSALSY LGKMMKLGIE PDIVTASSLV NGFCLSNSIK DAVYVAGQME KMGIKRDVVV       120
     DTILIDTLCK NRLVVPALEV LKRMKDRGIS PNVVTYSSLI TGLCKSGRLA DAERRLHEMD       180
     SKKINPNVIT FSALIDAYAK RGKLSKVDSV YKMMIQMSID PNVFTYSSLI YGLCMHNRVD       240
     EAIKMLDLMI SKGCTPNVVT YSTLANGFFK SSRVDDGIKL LDDMPQRGVA ANTVSCNTLI       300
     KGYFQAGKID LALGVFGYMT SNGLIPNIRS YNIVLAGLFA NGEVEKALSR FEHMQKTRND       360
     LDIITYTIMI HGMCKACMVK EAYDLFYKLK FKRVEPDFKA YTIMIAELNR AGMRTEADAL       420
     NRFYQKHVRQ NESAPAEVS                                                    439
//

If you have problems or comments...

PBIL Back to PBIL home page