(data stored in SCRATCH zone)

EMBL: AL161565.AT4G26810

AL161565.AT4G26810   Location/Qualifiers
FT   CDS             complement(join(189422..189568,189651..189824))
FT                   /gene="AT4g26810"
FT                   /product="putative protein"
FT                   /note="similarity to other Arabidopsis hypothetical
FT                   proteins"
FT                   /note="contains EST gb:AA713223"
FT                   /db_xref="InterPro:IPR003121"
FT                   /db_xref="InterPro:IPR019835"
FT                   /db_xref="InterPro:IPR036885"
FT                   /db_xref="UniProtKB/TrEMBL:Q9SZ21"
FT                   /protein_id="CAB79536.1"
FT                   /translation="MLPQRLKKAITDNPKKLGNLIDLVNLPSTLRNFVGQSQISRLGCF
FT                   MRVWSYIKTNNLQDPKNKNVVICDEKLKSILLGKQRVELVDLPSLIKLHFPKEQKKNSQ
FT                   KI"
     MLPQRLKKAI TDNPKKLGNL IDLVNLPSTL RNFVGQSQIS RLGCFMRVWS YIKTNNLQDP        60
     KNKNVVICDE KLKSILLGKQ RVELVDLPSL IKLHFPKEQK KNSQKI                      106
//

If you have problems or comments...

PBIL Back to PBIL home page