(data stored in SCRATCH zone)

EMBL: AL161565.AT4G26820

AL161565.AT4G26820   Location/Qualifiers
FT   CDS             complement(190628..191356)
FT                   /gene="AT4g26820"
FT                   /product="hypothetical protein"
FT                   /note="Contains Prokaryotic membrane lipoprotein lipid
FT                   attachment site AA53-63"
FT                   /db_xref="GOA:Q9SZ22"
FT                   /db_xref="UniProtKB/TrEMBL:Q9SZ22"
FT                   /protein_id="CAB79537.1"
FT                   /translation="MDDEQNLVEEMNQQLLITVIDTEKVPELRPISSRSHQESEPANIS
FT                   HWSLLFKLFLAITIMGACVAGVTFVILITPTPPTVHVQSMHISFANHNLPVWSATFSIK
FT                   NPNEKLHVTYENPSVWLVHRGKLVSTARADSFWQKGGEKNEVIVKRNETKVIDEEAAWE
FT                   MEDEVAVTGGVVGLDMVFSGRVGFYPGTSALWGEQYMSAVCENVSAKLYNVDDEIYGTN
FT                   RSVLSFDGRLVCSVRLPKYP"
     MDDEQNLVEE MNQQLLITVI DTEKVPELRP ISSRSHQESE PANISHWSLL FKLFLAITIM        60
     GACVAGVTFV ILITPTPPTV HVQSMHISFA NHNLPVWSAT FSIKNPNEKL HVTYENPSVW       120
     LVHRGKLVST ARADSFWQKG GEKNEVIVKR NETKVIDEEA AWEMEDEVAV TGGVVGLDMV       180
     FSGRVGFYPG TSALWGEQYM SAVCENVSAK LYNVDDEIYG TNRSVLSFDG RLVCSVRLPK       240
     YP                                                                      242
//

If you have problems or comments...

PBIL Back to PBIL home page