(data stored in SCRATCH zone)

EMBL: AL161565.AT4G26840

AL161565.AT4G26840   Location/Qualifiers
FT   CDS             join(194641..194715,195325..195474,195556..195633)
FT                   /gene="AT4g26840"
FT                   /product="ubiquitin-like protein"
FT                   /note="strong similarity to ubiquitin-like protein -
FT                   Arabidopsis thaliana (thale cress), PID:e259962"
FT                   /note="Contains Inorganic pyrophosphatase signature
FT                   AA80-86"
FT                   /note="contains EST gb:AI993416.1, N97261, AI100083,
FT                   T76809, H76365, Z17481, AW004209.1, F15343"
FT                   /db_xref="GOA:P55852"
FT                   /db_xref="InterPro:IPR000626"
FT                   /db_xref="InterPro:IPR022617"
FT                   /db_xref="InterPro:IPR029071"
FT                   /db_xref="UniProtKB/Swiss-Prot:P55852"
FT                   /protein_id="CAB79539.1"
FT                   /translation="MSANQEEDKKPGDGGAHINLKVKGQDGNEVFFRIKRSTQLKKLMN
FT                   AYCDRQSVDMNSIAFLFDGRRLRAEQTPDELDMEDGDEIDAMLHQTGGSGGGATA"
     MSANQEEDKK PGDGGAHINL KVKGQDGNEV FFRIKRSTQL KKLMNAYCDR QSVDMNSIAF        60
     LFDGRRLRAE QTPDELDMED GDEIDAMLHQ TGGSGGGATA                             100
//

If you have problems or comments...

PBIL Back to PBIL home page