(data stored in SCRATCH zone)

EMBL: AL161565.AT4G26850

AL161565.AT4G26850   Location/Qualifiers
FT   CDS             complement(join(196437..196796,196880..197128,
FT                   197224..197404,197478..197746,197860..197919,
FT                   198002..198113,198172..198320))
FT                   /gene="AT4g26850"
FT                   /product="putative protein"
FT                   /note="contains EST gb:AI997404.1, H36924, AA598191,
FT                   AA404925, R90050, N96762, N96025, AA651325, AA605436,
FT                   AI993313.1"
FT                   /db_xref="GOA:Q8RWE8"
FT                   /db_xref="InterPro:IPR026506"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8RWE8"
FT                   /protein_id="CAB79540.1"
FT                   /translation="MLKIKRVPTVVSNYQKDDGAEDPVGCGRNCLGACCLNGTFWKPES
FT                   SFLIMLPLYACKNLVKSGEKLVISHEAIEPPVAFLESLVLGEWEDRFQRGLFRYDVTAC
FT                   ETKVIPGKYGFVAQLNEGRHLKKRPTEFRVDKVLQSFDGSKFNFTKVGQEELLFQFEAG
FT                   EDAQVQFFPCMPIDPENSPSVVAINVKTLVQRACPIEYGHVLLIPRVLDCLPQRIDHKS
FT                   LLLAVHMAAEAANPYFRLGYNSLGAFATINHLHFQAYYLAMPFPLEKAPTKKITTTVSG
FT                   VKISELLSYPVRSLLFEGGSSMQELSDTVSDCCVCLQNNNIPFNILISDCGRQIFLMPQ
FT                   CYAEKQALGEVSPEVLETQVNPAVWEISGHMVLKRKEDYEGASEDNAWRLLAEASLSEE
FT                   RFKEVTALAFEAIGCSNQEEDLEGTIVHQQNSSGNVNQKSNRTHGGPITNGTAAECLVL
FT                   Q"
     MLKIKRVPTV VSNYQKDDGA EDPVGCGRNC LGACCLNGTF WKPESSFLIM LPLYACKNLV        60
     KSGEKLVISH EAIEPPVAFL ESLVLGEWED RFQRGLFRYD VTACETKVIP GKYGFVAQLN       120
     EGRHLKKRPT EFRVDKVLQS FDGSKFNFTK VGQEELLFQF EAGEDAQVQF FPCMPIDPEN       180
     SPSVVAINVK TLVQRACPIE YGHVLLIPRV LDCLPQRIDH KSLLLAVHMA AEAANPYFRL       240
     GYNSLGAFAT INHLHFQAYY LAMPFPLEKA PTKKITTTVS GVKISELLSY PVRSLLFEGG       300
     SSMQELSDTV SDCCVCLQNN NIPFNILISD CGRQIFLMPQ CYAEKQALGE VSPEVLETQV       360
     NPAVWEISGH MVLKRKEDYE GASEDNAWRL LAEASLSEER FKEVTALAFE AIGCSNQEED       420
     LEGTIVHQQN SSGNVNQKSN RTHGGPITNG TAAECLVLQ                              459
//

If you have problems or comments...

PBIL Back to PBIL home page