(data stored in SCRATCH3701 zone)

EMBL: AL591973.GYRA

AL591973.GYRA        Location/Qualifiers
FT   CDS             8065..10593
FT                   /transl_table=11
FT                   /gene="gyrA"
FT                   /product="DNA gyrase subunit A"
FT                   /db_xref="GOA:Q8YAV6"
FT                   /db_xref="InterPro:IPR002205"
FT                   /db_xref="InterPro:IPR005743"
FT                   /db_xref="InterPro:IPR006691"
FT                   /db_xref="InterPro:IPR013757"
FT                   /db_xref="InterPro:IPR013758"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR035516"
FT                   /db_xref="UniProtKB/TrEMBL:Q8YAV6"
FT                   /protein_id="CAC98222.1"
FT                   /translation="MAETPNQRITEINLNKEMRTSFLDYAMSVIVARALPDVRDGLKPV
FT                   HRRILYAMNDLGMTSDKAYKKSARIVGEVIGKYHPHGDTAVYFTMVRMAQDFSYRNMLV
FT                   DGHGNFGSVDGDMAAAMRYTEARMSKISMELLRDINKDTIDYADNYDGSEREPVILPAR
FT                   FPNLLVNGSSGIAVGMATNIPTHHLGEVIDGVLALSHDPEITIRDLMEYIPGPDFPTAG
FT                   MIMGRSGIRRAYESGRGSITVRGRVDIEEKKNGKETIVITEIPYQVNKARLVERIAELA
FT                   REKKIDGITSLNDESDRSGMRIVIEVRRDISASVIVNNLFKMTALQTTFGINMLALVDN
FT                   HPKVLNLKEILYYYLEHQKVVIRRRTEFELRKAEARAHILEGLRIALDNIDAIIKLIRG
FT                   SKTSDVAKEGLMTQFNLSDKQAQAILDMRLQRLTGLEREKIEEEYQNLVALINDLKAIL
FT                   ADDERILEIIREELEEIKVKYADKRRTEILAGDLVSLEDEDLIPEEEVAITLTKRGYIK
FT                   RLPLSTYRSQRRGGRGIQGMSTHEDDFVEHLVATSTHDTLLFFTNTGKVYRSKGYEVPE
FT                   YGRTAKGIPIINLLGIESQEQVNAVINLSEFTDDSYLFFTTKHGVVKRTTLSQFAKIRQ
FT                   SGLRAVELRENDELISVQMTDGSKNMIIATKHGQSIYFPEENIRVMGRTAAGVRGIRLR
FT                   EDDEVIGMEVLEDDEKVLVVTEKGYGKQTPASQYPLRNRGGMGVKTVTITEKNGNLVAM
FT                   KTVTGEEDLMLMTVSGVLIRFEIDTVSQTGRSAMGVKLIRLDEDEKVATVAKVPKEEDE
FT                   VELEEEIDETLITQVPDESFEDAPGSDIEE"
     MAETPNQRIT EINLNKEMRT SFLDYAMSVI VARALPDVRD GLKPVHRRIL YAMNDLGMTS        60
     DKAYKKSARI VGEVIGKYHP HGDTAVYFTM VRMAQDFSYR NMLVDGHGNF GSVDGDMAAA       120
     MRYTEARMSK ISMELLRDIN KDTIDYADNY DGSEREPVIL PARFPNLLVN GSSGIAVGMA       180
     TNIPTHHLGE VIDGVLALSH DPEITIRDLM EYIPGPDFPT AGMIMGRSGI RRAYESGRGS       240
     ITVRGRVDIE EKKNGKETIV ITEIPYQVNK ARLVERIAEL AREKKIDGIT SLNDESDRSG       300
     MRIVIEVRRD ISASVIVNNL FKMTALQTTF GINMLALVDN HPKVLNLKEI LYYYLEHQKV       360
     VIRRRTEFEL RKAEARAHIL EGLRIALDNI DAIIKLIRGS KTSDVAKEGL MTQFNLSDKQ       420
     AQAILDMRLQ RLTGLEREKI EEEYQNLVAL INDLKAILAD DERILEIIRE ELEEIKVKYA       480
     DKRRTEILAG DLVSLEDEDL IPEEEVAITL TKRGYIKRLP LSTYRSQRRG GRGIQGMSTH       540
     EDDFVEHLVA TSTHDTLLFF TNTGKVYRSK GYEVPEYGRT AKGIPIINLL GIESQEQVNA       600
     VINLSEFTDD SYLFFTTKHG VVKRTTLSQF AKIRQSGLRA VELRENDELI SVQMTDGSKN       660
     MIIATKHGQS IYFPEENIRV MGRTAAGVRG IRLREDDEVI GMEVLEDDEK VLVVTEKGYG       720
     KQTPASQYPL RNRGGMGVKT VTITEKNGNL VAMKTVTGEE DLMLMTVSGV LIRFEIDTVS       780
     QTGRSAMGVK LIRLDEDEKV ATVAKVPKEE DEVELEEEID ETLITQVPDE SFEDAPGSDI       840
     EE                                                                      842
//

If you have problems or comments...

PBIL Back to PBIL home page