(data stored in SCRATCH3701 zone)

EMBL: AL591973.LMAA

AL591973.LMAA        Location/Qualifiers
FT   CDS             123200..123712
FT                   /transl_table=11
FT                   /gene="lmaA"
FT                   /product="antigen A"
FT                   /db_xref="InterPro:IPR011855"
FT                   /db_xref="UniProtKB/TrEMBL:Q7AP93"
FT                   /protein_id="CAC98333.1"
FT                   /translation="MAFEENLYCDYTPGAAKAVAGKDVILAVFNAAGDKLLAVAGQQGL
FT                   TVNRSKDSIEITSKDTVGGWKSKIGGMKEWSIENDGLYVADAESHKELAKYFESDSPVC
FT                   VKIINQASKKGLFGGLAIVADYSFEAPFDEAMTYSVKLDGMGALVDLTITEGGDQMPGE
FT                   TPVAPAE"
     MAFEENLYCD YTPGAAKAVA GKDVILAVFN AAGDKLLAVA GQQGLTVNRS KDSIEITSKD        60
     TVGGWKSKIG GMKEWSIEND GLYVADAESH KELAKYFESD SPVCVKIINQ ASKKGLFGGL       120
     AIVADYSFEA PFDEAMTYSV KLDGMGALVD LTITEGGDQM PGETPVAPAE                  170
//

If you have problems or comments...

PBIL Back to PBIL home page