(data stored in SCRATCH3701 zone)

EMBL: AL591973.LMAB

AL591973.LMAB        Location/Qualifiers
FT   CDS             122798..123187
FT                   /transl_table=11
FT                   /gene="lmaB"
FT                   /product="antigen B"
FT                   /db_xref="UniProtKB/TrEMBL:Q7AP94"
FT                   /protein_id="CAC98332.1"
FT                   /translation="MKSLSFMRVLEAVRTMLQEKGGLDISIVMRDQVEMPTTMIEMIDQ
FT                   EEEESQTAWKEKYRFAIHHYTNETDLAGVEKIDTLIQTGFTLPEGYKLIAVRHYGKQNL
FT                   VKENTLIHAKTSFEVSICRELKVKI"
     MKSLSFMRVL EAVRTMLQEK GGLDISIVMR DQVEMPTTMI EMIDQEEEES QTAWKEKYRF        60
     AIHHYTNETD LAGVEKIDTL IQTGFTLPEG YKLIAVRHYG KQNLVKENTL IHAKTSFEVS       120
     ICRELKVKI                                                               129
//

If you have problems or comments...

PBIL Back to PBIL home page