(data stored in SCRATCH3701 zone)

EMBL: AL591973.LMAC

AL591973.LMAC        Location/Qualifiers
FT   CDS             122104..122520
FT                   /transl_table=11
FT                   /gene="lmaC"
FT                   /note="similar to Antigen C"
FT                   /db_xref="InterPro:IPR006524"
FT                   /db_xref="UniProtKB/TrEMBL:Q7AP95"
FT                   /protein_id="CAC98331.1"
FT                   /translation="MQVLVLPENKDINYIKTVQEVKRFFADFERFRMITGLSKKPHLLR
FT                   NGFLEEPQFEPVAFSARHNKEVILEARWLVEKYTEMLNQMDDLYRTILMECYVERKQDV
FT                   AVMMDLPYEIAQFKRIKKRAVLELATLMGILVRK"
     MQVLVLPENK DINYIKTVQE VKRFFADFER FRMITGLSKK PHLLRNGFLE EPQFEPVAFS        60
     ARHNKEVILE ARWLVEKYTE MLNQMDDLYR TILMECYVER KQDVAVMMDL PYEIAQFKRI       120
     KKRAVLELAT LMGILVRK                                                     138
//

If you have problems or comments...

PBIL Back to PBIL home page