(data stored in SCRATCH3701 zone)

EMBL: AL591973.LMAD

AL591973.LMAD        Location/Qualifiers
FT   CDS             121664..122092
FT                   /transl_table=11
FT                   /gene="lmaD"
FT                   /note="similar to Antigen D"
FT                   /db_xref="UniProtKB/TrEMBL:Q7AP96"
FT                   /protein_id="CAC98330.1"
FT                   /translation="MDRKLLKEKQIQLIFQLEQEENRFIRKRLIEELEFFEALGDREKG
FT                   LLTAEQKLLILTPSEYREYKRTKSDVQISRIIGVSRSSLAEWKRKKGLNRKKSQPVQQE
FT                   MIDVLAFHLDKTKEEIGALPASAIECQYEAFVINEANN"
     MDRKLLKEKQ IQLIFQLEQE ENRFIRKRLI EELEFFEALG DREKGLLTAE QKLLILTPSE        60
     YREYKRTKSD VQISRIIGVS RSSLAEWKRK KGLNRKKSQP VQQEMIDVLA FHLDKTKEEI       120
     GALPASAIEC QYEAFVINEA NN                                                142
//

If you have problems or comments...

PBIL Back to PBIL home page