(data stored in SCRATCH3701 zone)

EMBL: AL591973.LMO0003

AL591973.LMO0003     Location/Qualifiers
FT   CDS             3121..4464
FT                   /transl_table=11
FT                   /gene="lmo0003"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="GOA:Q8YAW0"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:Q8YAW0"
FT                   /protein_id="CAC98218.1"
FT                   /translation="MMKDMTTGNPTKLIFLFAMPMLIGNLFQQFYTMIDAVIVGKFVSV
FT                   DALAAVGATNSVNFFMISLIIGLMSGISVVVAQYFGFKDYDRLKDVIATATYAVVFSAI
FT                   ILTVAGVLLAKPLLILLRTPANILDDSTIFLTTLFIGILPMSLYNGMAAILRALGNSIT
FT                   PLIFLILSSLMNIALDFLFVVYMDMGVRGAAIATVLSQTAAAIAVIYYAYRHVPFMRIE
FT                   RAKFKLSTPLLKEMVRIGLPSGLQGSFISIGNMALQSLINGFGSSVVAAYTAASRIDSL
FT                   TYQPGIAFGAASSMFAGQNIGAGKIDRVREGFWSGIKVVTAISIGITILVQLFARQFLL
FT                   LFVDSSETEVINIGVSYLLIVSLFYVVVGILFVVRETLRGTGDAMVPLAMGIFELVSRL
FT                   VIGFVLSLYIGYVGLWWATPVAWITATILGVWRYKSGAWQKKAVIRRK"
     MMKDMTTGNP TKLIFLFAMP MLIGNLFQQF YTMIDAVIVG KFVSVDALAA VGATNSVNFF        60
     MISLIIGLMS GISVVVAQYF GFKDYDRLKD VIATATYAVV FSAIILTVAG VLLAKPLLIL       120
     LRTPANILDD STIFLTTLFI GILPMSLYNG MAAILRALGN SITPLIFLIL SSLMNIALDF       180
     LFVVYMDMGV RGAAIATVLS QTAAAIAVIY YAYRHVPFMR IERAKFKLST PLLKEMVRIG       240
     LPSGLQGSFI SIGNMALQSL INGFGSSVVA AYTAASRIDS LTYQPGIAFG AASSMFAGQN       300
     IGAGKIDRVR EGFWSGIKVV TAISIGITIL VQLFARQFLL LFVDSSETEV INIGVSYLLI       360
     VSLFYVVVGI LFVVRETLRG TGDAMVPLAM GIFELVSRLV IGFVLSLYIG YVGLWWATPV       420
     AWITATILGV WRYKSGAWQK KAVIRRK                                           447
//

If you have problems or comments...

PBIL Back to PBIL home page