(data stored in SCRATCH3701 zone)

EMBL: AL591973.LMO0010

AL591973.LMO0010     Location/Qualifiers
FT   CDS             12918..13886
FT                   /transl_table=11
FT                   /gene="lmo0010"
FT                   /note="similar to mevalonate kinase"
FT                   /db_xref="GOA:Q8YAV3"
FT                   /db_xref="InterPro:IPR006203"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR006205"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/TrEMBL:Q8YAV3"
FT                   /protein_id="CAC98225.1"
FT                   /translation="MATGIGTAKMILCGEHAVVYGEPAISVPFTQAVVTTNVETSIKTK
FT                   FSSAFFSGDLDDMPDFLAGIKALVVDVLNEIGNGECVSIHVVSGVPIGRGLGSSAAVAT
FT                   SIARGLYKYFNQELDSKKLLAIVNAAEKIAHGNASGVDAITVVSEKPVWYERDRKLEIM
FT                   HFPKKITFVVADTGVPSETRDAVKDVQVLYKENQVEIGKIIHQLGDISREIKTHLEGDA
FT                   DTVKIGAAMNKAQSYLETLTVSDSSLEKLIKVARSNGADGAKLTGGGRGGCIIAVAKNQ
FT                   EIAEQITKALHNAGAAQEWIFTIGEGSYESDSHRTHECGAN"
     MATGIGTAKM ILCGEHAVVY GEPAISVPFT QAVVTTNVET SIKTKFSSAF FSGDLDDMPD        60
     FLAGIKALVV DVLNEIGNGE CVSIHVVSGV PIGRGLGSSA AVATSIARGL YKYFNQELDS       120
     KKLLAIVNAA EKIAHGNASG VDAITVVSEK PVWYERDRKL EIMHFPKKIT FVVADTGVPS       180
     ETRDAVKDVQ VLYKENQVEI GKIIHQLGDI SREIKTHLEG DADTVKIGAA MNKAQSYLET       240
     LTVSDSSLEK LIKVARSNGA DGAKLTGGGR GGCIIAVAKN QEIAEQITKA LHNAGAAQEW       300
     IFTIGEGSYE SDSHRTHECG AN                                                322
//

If you have problems or comments...

PBIL Back to PBIL home page