(data stored in SCRATCH3701 zone)

EMBL: AL591973.LMO0017

AL591973.LMO0017     Location/Qualifiers
FT   CDS             complement(20308..21426)
FT                   /transl_table=11
FT                   /gene="lmo0017"
FT                   /note="similar to Bacillus anthracis CapA protein
FT                   (polyglutamate capsule biosynthesis)"
FT                   /db_xref="GOA:Q8YAU6"
FT                   /db_xref="InterPro:IPR019079"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:Q8YAU6"
FT                   /protein_id="CAC98232.1"
FT                   /translation="MKSRKKGIILVLSVILIFSIGLLVNNLMTNNKDTAKPKKKTVAAV
FT                   KKKKETPPKPKEPFNIDFTGDIMFDWDLRPVLAEKGMDYPFNNVREELKSSDYTFVDLE
FT                   TAITTRTKKVPYQEFWIKSDPSSLTALKNAGVDMVNISNNHILDYYEDGLLDTTAALRA
FT                   NNLAYVGAGKNEDEAYQLKVADIKGNKVGFMSFCHFFPNTGWIADEDTPGVTNGYDLNL
FT                   VEEKIKEERAKNKDIDYMVVYFHWGVEKTNTPVDYQTQYVKKLVDDNLVDAIVASHPHW
FT                   LQGFEVYKDVPIAYSLGNFLFPDYVSGHSAETGIYKLNFDQGKVTAHFDPGIISGNQIN
FT                   MLEGSSKTAQLNYLQSISPNATINSNGDISAK"
     MKSRKKGIIL VLSVILIFSI GLLVNNLMTN NKDTAKPKKK TVAAVKKKKE TPPKPKEPFN        60
     IDFTGDIMFD WDLRPVLAEK GMDYPFNNVR EELKSSDYTF VDLETAITTR TKKVPYQEFW       120
     IKSDPSSLTA LKNAGVDMVN ISNNHILDYY EDGLLDTTAA LRANNLAYVG AGKNEDEAYQ       180
     LKVADIKGNK VGFMSFCHFF PNTGWIADED TPGVTNGYDL NLVEEKIKEE RAKNKDIDYM       240
     VVYFHWGVEK TNTPVDYQTQ YVKKLVDDNL VDAIVASHPH WLQGFEVYKD VPIAYSLGNF       300
     LFPDYVSGHS AETGIYKLNF DQGKVTAHFD PGIISGNQIN MLEGSSKTAQ LNYLQSISPN       360
     ATINSNGDIS AK                                                           372
//

If you have problems or comments...

PBIL Back to PBIL home page