(data stored in SCRATCH3701 zone)

EMBL: AL591973.LMO0026

AL591973.LMO0026     Location/Qualifiers
FT   CDS             28254..28895
FT                   /transl_table=11
FT                   /gene="lmo0026"
FT                   /note="similar to E. coli copper homeostasis protein CutC"
FT                   /db_xref="GOA:Q8YAT7"
FT                   /db_xref="InterPro:IPR005627"
FT                   /db_xref="InterPro:IPR023648"
FT                   /db_xref="InterPro:IPR036822"
FT                   /db_xref="UniProtKB/TrEMBL:Q8YAT7"
FT                   /protein_id="CAC98241.1"
FT                   /translation="MILKEVCIENTTNLVNVIEAGANRVELCDNLAEGGTSVSYGVAKH
FT                   VVKICHEQNVSVMAMVRPRKGNFVYTKEEISVMIDDILMYKKIAVDGVVFGCITDSGLL
FT                   DKPAINELLKAAAGLEVTFHMAFDELVETEKLSAIDWLVEQGVTRILTHGGDGAKLPEE
FT                   TFVQWRKYIDYAAGRIIILPGGGIKSHNLEWIIKETGAAEIHGTDLFGER"
     MILKEVCIEN TTNLVNVIEA GANRVELCDN LAEGGTSVSY GVAKHVVKIC HEQNVSVMAM        60
     VRPRKGNFVY TKEEISVMID DILMYKKIAV DGVVFGCITD SGLLDKPAIN ELLKAAAGLE       120
     VTFHMAFDEL VETEKLSAID WLVEQGVTRI LTHGGDGAKL PEETFVQWRK YIDYAAGRII       180
     ILPGGGIKSH NLEWIIKETG AAEIHGTDLF GER                                    213
//

If you have problems or comments...

PBIL Back to PBIL home page