(data stored in SCRATCH3701 zone)

EMBL: AL591973.LMO0027

AL591973.LMO0027     Location/Qualifiers
FT   CDS             29100..31004
FT                   /transl_table=11
FT                   /gene="lmo0027"
FT                   /note="similar to PTS system, beta-glucosides specific
FT                   enzyme IIABC"
FT                   /db_xref="GOA:Q8YAT6"
FT                   /db_xref="InterPro:IPR001127"
FT                   /db_xref="InterPro:IPR001996"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR011297"
FT                   /db_xref="InterPro:IPR013013"
FT                   /db_xref="InterPro:IPR018113"
FT                   /db_xref="InterPro:IPR036878"
FT                   /db_xref="UniProtKB/TrEMBL:Q8YAT6"
FT                   /protein_id="CAC98242.1"
FT                   /translation="MKYEQLAKDILKNVGGKENINSVFHCITRLRFKLKDENIANTKEI
FT                   EKLDGVISVIKSGGQYQVVIGNHVPDVFKAVLEVGGISAEGDEGSSAPATGNIFNRFID
FT                   MISGVFTPVLGVLAATGMIKGFTAMFVAFGWITVTSGTYQLLYAIGDCLFYFFPIFLGY
FT                   TAMKKFGGNIFIGMAIGGALVYPTLAGITAGDPLYTLFAGTIFESPIHVTFLGIPVILM
FT                   SYASSVIPIIVATYFGSKVEKGFKKIIPDVIKTFVVPFCTLLIVVPITFIVIGPIATWA
FT                   GQLLGAGTIWVYNLSPIIAGLILGGFWQVFVIFGLHWGLVPVAINNLTVLGHDPILAMT
FT                   FGASFAQIGAVLAVFFKSRNKKIKSLSIPAFISGIFGVTEPAIYGVTLPLKKPFIMSCI
FT                   AGGIGGGIIGFAGSQTYIMGGLGIFGLPNFFKPGSGISGEFWWVVIAIVISFILGFILT
FT                   YVVGFKDPADVVVEQSNTVEGETLIERETIPAPVVGEIVTLADVKDEAFSSGALGKGVA
FT                   IIPTVGRVVAPAAGTVTTIFPTGHAIGITTKDGAEVLIHIGMDTVQLEGKFFTAHVKQG
FT                   DVIEKGQLLTEFDIEGIKAAGYDVTTPVVVTNSNQYLDVMITDAKEAKLEERLITLVI"
     MKYEQLAKDI LKNVGGKENI NSVFHCITRL RFKLKDENIA NTKEIEKLDG VISVIKSGGQ        60
     YQVVIGNHVP DVFKAVLEVG GISAEGDEGS SAPATGNIFN RFIDMISGVF TPVLGVLAAT       120
     GMIKGFTAMF VAFGWITVTS GTYQLLYAIG DCLFYFFPIF LGYTAMKKFG GNIFIGMAIG       180
     GALVYPTLAG ITAGDPLYTL FAGTIFESPI HVTFLGIPVI LMSYASSVIP IIVATYFGSK       240
     VEKGFKKIIP DVIKTFVVPF CTLLIVVPIT FIVIGPIATW AGQLLGAGTI WVYNLSPIIA       300
     GLILGGFWQV FVIFGLHWGL VPVAINNLTV LGHDPILAMT FGASFAQIGA VLAVFFKSRN       360
     KKIKSLSIPA FISGIFGVTE PAIYGVTLPL KKPFIMSCIA GGIGGGIIGF AGSQTYIMGG       420
     LGIFGLPNFF KPGSGISGEF WWVVIAIVIS FILGFILTYV VGFKDPADVV VEQSNTVEGE       480
     TLIERETIPA PVVGEIVTLA DVKDEAFSSG ALGKGVAIIP TVGRVVAPAA GTVTTIFPTG       540
     HAIGITTKDG AEVLIHIGMD TVQLEGKFFT AHVKQGDVIE KGQLLTEFDI EGIKAAGYDV       600
     TTPVVVTNSN QYLDVMITDA KEAKLEERLI TLVI                                   634
//

If you have problems or comments...

PBIL Back to PBIL home page