(data stored in SCRATCH3701 zone)

EMBL: AL591973.LMO0028

AL591973.LMO0028     Location/Qualifiers
FT   CDS             31088..31963
FT                   /transl_table=11
FT                   /gene="lmo0028"
FT                   /note="similar to E. coli microcin C7 self-immunity protein
FT                   (MccF)"
FT                   /db_xref="InterPro:IPR003507"
FT                   /db_xref="InterPro:IPR027461"
FT                   /db_xref="InterPro:IPR027478"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR040449"
FT                   /db_xref="InterPro:IPR040921"
FT                   /db_xref="UniProtKB/TrEMBL:Q8YAT5"
FT                   /protein_id="CAC98243.1"
FT                   /translation="MLVKGDTVGIICCSDGRKKEDENRIALLEQVLKTEFSLQVVFAET
FT                   IFQKAESPFSGTPQARAIELMKLYQRSDVQMIFDISGGDAANQVLPYLDFDIIRNAQKP
FT                   FVGYSDLTVILNAIYTKTEQMGYNYQLLHLVGKDSELQQSHFRKTFFENRVLISGEQLN
FT                   EFVWRGGEVIGGNIRCFLKLAGTNFMPDFTNKIILLESLGGKEAKLASYVAQLEQLGAF
FT                   SKCLGVIVGQHSEAEENGEYERIGRLYQQIGRKYKLPIFRTSEIGHSVDAKPCLIGAKV
FT                   NVSRETLTNF"
     MLVKGDTVGI ICCSDGRKKE DENRIALLEQ VLKTEFSLQV VFAETIFQKA ESPFSGTPQA        60
     RAIELMKLYQ RSDVQMIFDI SGGDAANQVL PYLDFDIIRN AQKPFVGYSD LTVILNAIYT       120
     KTEQMGYNYQ LLHLVGKDSE LQQSHFRKTF FENRVLISGE QLNEFVWRGG EVIGGNIRCF       180
     LKLAGTNFMP DFTNKIILLE SLGGKEAKLA SYVAQLEQLG AFSKCLGVIV GQHSEAEENG       240
     EYERIGRLYQ QIGRKYKLPI FRTSEIGHSV DAKPCLIGAK VNVSRETLTN F                291
//

If you have problems or comments...

PBIL Back to PBIL home page