(data stored in SCRATCH3701 zone)

EMBL: AL591973.LMO0030

AL591973.LMO0030     Location/Qualifiers
FT   CDS             complement(32571..33380)
FT                   /transl_table=11
FT                   /gene="lmo0030"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="GOA:Q8YAT3"
FT                   /db_xref="InterPro:IPR000150"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:Q8YAT3"
FT                   /protein_id="CAC98245.1"
FT                   /translation="MEKYLICSDLDGTLLLKNQTISPKTLNLLQQLIEEGHHFAVSTGR
FT                   MYNSATDFAKLVHPKADVIASNGGVVAVSGEIIQQEKMKQSALLETFLLCQNHDLPVFF
FT                   FSTDTVFYTKNPPYYFTDEEDKGRVNATKLVAIKSREIFLEHADQFINGIVIEEEDFDK
FT                   LAVLRSDLEKLSDVSILSSHANNIEILPKDMDKKYAVKNLAAHLNIKPENVITFGDGEN
FT                   DIGMLEVAGAGVAMENASELVKKSADFVTTANDADGIYYFLKKHLNR"
     MEKYLICSDL DGTLLLKNQT ISPKTLNLLQ QLIEEGHHFA VSTGRMYNSA TDFAKLVHPK        60
     ADVIASNGGV VAVSGEIIQQ EKMKQSALLE TFLLCQNHDL PVFFFSTDTV FYTKNPPYYF       120
     TDEEDKGRVN ATKLVAIKSR EIFLEHADQF INGIVIEEED FDKLAVLRSD LEKLSDVSIL       180
     SSHANNIEIL PKDMDKKYAV KNLAAHLNIK PENVITFGDG ENDIGMLEVA GAGVAMENAS       240
     ELVKKSADFV TTANDADGIY YFLKKHLNR                                         269
//

If you have problems or comments...

PBIL Back to PBIL home page