(data stored in SCRATCH3701 zone)

EMBL: AL591973.LMO0035

AL591973.LMO0035     Location/Qualifiers
FT   CDS             39385..40470
FT                   /transl_table=11
FT                   /gene="lmo0035"
FT                   /note="similar to Glucosamine--fructose-6-phosphate
FT                   aminotransferase (C-terminal domain)"
FT                   /db_xref="GOA:Q8YAS8"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR035466"
FT                   /db_xref="InterPro:IPR035490"
FT                   /db_xref="UniProtKB/TrEMBL:Q8YAS8"
FT                   /protein_id="CAC98250.1"
FT                   /translation="MKPTMMTYINEEEEMCRAILANFQTNAEKLESLVKNGAKEWLILA
FT                   TGSSLNAAQSAKYYIENIADVRITVEEPFNHLYYEKLSNHLDLVIGISQSGQSTSTISA
FT                   LERVKKEASVPVVALTSDVTSEIAEFADITLDIGSGKERVGYVTKGFTATVLTLMLTGL
FT                   HFAYKTAQIDETKFNNEINAFSRATNAIPATIAETEAFYERWQEEFATAPKFTAIGYGP
FT                   TVGTCKEFETKFSETVRVPSQGLDLEAFMHGPYLEVNPQHRIFFLETESAVTERLVALR
FT                   NYESKYTPFTYTVKFGTAGNDRTLLIPADLDEYQAPFLMILPFQILAHHIAELKGNKLT
FT                   ERIYTDFGVAMKSKTKPGDYA"
     MKPTMMTYIN EEEEMCRAIL ANFQTNAEKL ESLVKNGAKE WLILATGSSL NAAQSAKYYI        60
     ENIADVRITV EEPFNHLYYE KLSNHLDLVI GISQSGQSTS TISALERVKK EASVPVVALT       120
     SDVTSEIAEF ADITLDIGSG KERVGYVTKG FTATVLTLML TGLHFAYKTA QIDETKFNNE       180
     INAFSRATNA IPATIAETEA FYERWQEEFA TAPKFTAIGY GPTVGTCKEF ETKFSETVRV       240
     PSQGLDLEAF MHGPYLEVNP QHRIFFLETE SAVTERLVAL RNYESKYTPF TYTVKFGTAG       300
     NDRTLLIPAD LDEYQAPFLM ILPFQILAHH IAELKGNKLT ERIYTDFGVA MKSKTKPGDY       360
     A                                                                       361
//

If you have problems or comments...

PBIL Back to PBIL home page