(data stored in SCRATCH3701 zone)

EMBL: AL591973.LMO0037

AL591973.LMO0037     Location/Qualifiers
FT   CDS             41803..43188
FT                   /transl_table=11
FT                   /gene="lmo0037"
FT                   /note="similar to amino acid transporter"
FT                   /db_xref="GOA:Q8YAS6"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:Q8YAS6"
FT                   /protein_id="CAC98252.1"
FT                   /translation="MEKKKKFRLFDAVLMAVCVVLVVESAAPAAAIGSSQFFWWIALLI
FT                   LFFLPYGLVSAELGTTYDDEGGIYDWVKRAFGRKWGARVAWLYWINYPIWMASLAVLFV
FT                   EVITQIFPVSFGTPVSILIQLIFVWIVVIVSCYPVSDSKWILNIAAFCKVAIMLCLGVL
FT                   GIYFAITKGLANDFSGKALLPTFDLESLSFISVILFNFLGFEVVTTLASDMENPKKQIP
FT                   QAIIYGGILIAFFYLLAAFGMGAAIPTSELSTSGGLIDSFIMLIGGVNPFVIIIGIMFM
FT                   YTLVANLVSWALGVNYVAMYAAKNKDLPAVFGKTNPKNDMPTGTSILNGIVASVLIVAA
FT                   PLIPNENIFWAFFALNVVALLGSYILMFPAFLKLRKLDPDRERPFKVPGGKILLYLMTF
FT                   VPMILLIITLIFSAVPLNGSSAELNEKIPILIGTIVAVIVGEICIWLAGKRKDKGEIKN
FT                   END"
     MEKKKKFRLF DAVLMAVCVV LVVESAAPAA AIGSSQFFWW IALLILFFLP YGLVSAELGT        60
     TYDDEGGIYD WVKRAFGRKW GARVAWLYWI NYPIWMASLA VLFVEVITQI FPVSFGTPVS       120
     ILIQLIFVWI VVIVSCYPVS DSKWILNIAA FCKVAIMLCL GVLGIYFAIT KGLANDFSGK       180
     ALLPTFDLES LSFISVILFN FLGFEVVTTL ASDMENPKKQ IPQAIIYGGI LIAFFYLLAA       240
     FGMGAAIPTS ELSTSGGLID SFIMLIGGVN PFVIIIGIMF MYTLVANLVS WALGVNYVAM       300
     YAAKNKDLPA VFGKTNPKND MPTGTSILNG IVASVLIVAA PLIPNENIFW AFFALNVVAL       360
     LGSYILMFPA FLKLRKLDPD RERPFKVPGG KILLYLMTFV PMILLIITLI FSAVPLNGSS       420
     AELNEKIPIL IGTIVAVIVG EICIWLAGKR KDKGEIKNEN D                           461
//

If you have problems or comments...

PBIL Back to PBIL home page