(data stored in SCRATCH3701 zone)

EMBL: AL591973.LMO0038

AL591973.LMO0038     Location/Qualifiers
FT   CDS             43175..44266
FT                   /transl_table=11
FT                   /gene="lmo0038"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="GOA:Q8YAS5"
FT                   /db_xref="InterPro:IPR007466"
FT                   /db_xref="InterPro:IPR017754"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8YAS5"
FT                   /protein_id="CAC98253.1"
FT                   /translation="MRTIDSSSKKDGFRMPGEFEKHAGCYIIWPERPDNWRLGAKPAQK
FT                   AFVDVATAISHFEPVTVVASSSQYVNARYMLSDEIRVVEMDNDDAWVRDSGPTFVVNDS
FT                   GDVRGVDWSFNSWGGLVDGLYFPWDKDDQVAQKICELERKDRYRLADFVLEGGSIHVDG
FT                   EGTLVTTEECLLSEGRNPQLSKQQIEMVLKEYLNLEKIIWLKRGIYLDETNGHVDNIFN
FT                   YVRPGVVALAWTDDETDPQYEISKECFDILSNETDAKGRKLEVHKINVPKPILITDEES
FT                   KGVDAVEGTLPREEGDRLAASYINYYTANGGVIFPLFGDPNDELAREKLQQLYPNCEVV
FT                   GVKAREILLGGGNIHCITQQVPR"
     MRTIDSSSKK DGFRMPGEFE KHAGCYIIWP ERPDNWRLGA KPAQKAFVDV ATAISHFEPV        60
     TVVASSSQYV NARYMLSDEI RVVEMDNDDA WVRDSGPTFV VNDSGDVRGV DWSFNSWGGL       120
     VDGLYFPWDK DDQVAQKICE LERKDRYRLA DFVLEGGSIH VDGEGTLVTT EECLLSEGRN       180
     PQLSKQQIEM VLKEYLNLEK IIWLKRGIYL DETNGHVDNI FNYVRPGVVA LAWTDDETDP       240
     QYEISKECFD ILSNETDAKG RKLEVHKINV PKPILITDEE SKGVDAVEGT LPREEGDRLA       300
     ASYINYYTAN GGVIFPLFGD PNDELAREKL QQLYPNCEVV GVKAREILLG GGNIHCITQQ       360
     VPR                                                                     363
//

If you have problems or comments...

PBIL Back to PBIL home page