(data stored in SCRATCH3701 zone)

EMBL: AL591973.LMO0039

AL591973.LMO0039     Location/Qualifiers
FT   CDS             44282..45223
FT                   /transl_table=11
FT                   /gene="lmo0039"
FT                   /note="similar to carbamate kinase"
FT                   /db_xref="GOA:Q8YAS4"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR003964"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="UniProtKB/TrEMBL:Q8YAS4"
FT                   /protein_id="CAC98254.1"
FT                   /translation="MNQKIVVALGGNAILSSDASAEAQRSALEETAEYLVQFIENGDDL
FT                   IISHGNGPQVGNLMLQQHAGASEKNPAMPLDTCVAMTQGSIGYWMQNALDKAFLKHGLD
FT                   KVAVSLITQVVVDKDDPAFEKPTKPIGPFLNKEEAEKEMAETGAIFLEDAGRGYRKVVP
FT                   SPRPLSIKEHQIIKQLVDSGVVTISAGGGGVSVVENGLDLSGVETVIDKDFASEKLAEL
FT                   IDADLLVILTGVENVYINYNQPNQKKLEQVTVSELEKYIDEKQFAAGSMLPKIEAATAF
FT                   VKERPHAKAIITSLENIGAMLERGAGTVIVAG"
     MNQKIVVALG GNAILSSDAS AEAQRSALEE TAEYLVQFIE NGDDLIISHG NGPQVGNLML        60
     QQHAGASEKN PAMPLDTCVA MTQGSIGYWM QNALDKAFLK HGLDKVAVSL ITQVVVDKDD       120
     PAFEKPTKPI GPFLNKEEAE KEMAETGAIF LEDAGRGYRK VVPSPRPLSI KEHQIIKQLV       180
     DSGVVTISAG GGGVSVVENG LDLSGVETVI DKDFASEKLA ELIDADLLVI LTGVENVYIN       240
     YNQPNQKKLE QVTVSELEKY IDEKQFAAGS MLPKIEAATA FVKERPHAKA IITSLENIGA       300
     MLERGAGTVI VAG                                                          313
//

If you have problems or comments...

PBIL Back to PBIL home page