(data stored in SCRATCH3701 zone)

EMBL: AL591973.LMO0040

AL591973.LMO0040     Location/Qualifiers
FT   CDS             45325..46434
FT                   /transl_table=11
FT                   /gene="lmo0040"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="GOA:Q8YAS3"
FT                   /db_xref="InterPro:IPR007466"
FT                   /db_xref="InterPro:IPR017754"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8YAS3"
FT                   /protein_id="CAC98255.1"
FT                   /translation="MGQLKGLPVEDGFRMPGEYEPHIGCFMIWPERPDNWRLGGKPAQQ
FT                   NYKEVAVAISNFEPVTMFVSPNQYKNARKELPDTIRVIEMSNDDAWIRDYGPSFLVDDK
FT                   GDMRGVDWGFNAWGGLLDGLYFPWDKDNQIAKKVCELERIDYYSQKDFILEGCSIHVDG
FT                   EGTLVTTEECLLSEGRNPNLTKIEIEQTLKKYFHAQKVIWLKHGFYLDETNGHVDNIFN
FT                   FVAPGEVVLSWTDNKSDPQYEISRECYDILANKTDAKGRTFIIHKLHCPDPVLITQTES
FT                   EGVEAINGTFPRQAGDRLAASYVNYYTANGAIIFPLFDDPKDKDAQELLEKLYPDRKIV
FT                   GIKAREILLGGGNIHCITQHLPDKSTIRE"
     MGQLKGLPVE DGFRMPGEYE PHIGCFMIWP ERPDNWRLGG KPAQQNYKEV AVAISNFEPV        60
     TMFVSPNQYK NARKELPDTI RVIEMSNDDA WIRDYGPSFL VDDKGDMRGV DWGFNAWGGL       120
     LDGLYFPWDK DNQIAKKVCE LERIDYYSQK DFILEGCSIH VDGEGTLVTT EECLLSEGRN       180
     PNLTKIEIEQ TLKKYFHAQK VIWLKHGFYL DETNGHVDNI FNFVAPGEVV LSWTDNKSDP       240
     QYEISRECYD ILANKTDAKG RTFIIHKLHC PDPVLITQTE SEGVEAINGT FPRQAGDRLA       300
     ASYVNYYTAN GAIIFPLFDD PKDKDAQELL EKLYPDRKIV GIKAREILLG GGNIHCITQH       360
     LPDKSTIRE                                                               369
//

If you have problems or comments...

PBIL Back to PBIL home page