(data stored in SCRATCH3701 zone)

EMBL: AL591973.LMO0041

AL591973.LMO0041     Location/Qualifiers
FT   CDS             46451..47230
FT                   /transl_table=11
FT                   /gene="lmo0041"
FT                   /note="conserved hypothetical protein, hypothetical
FT                   regulator"
FT                   /db_xref="GOA:Q8YAS2"
FT                   /db_xref="InterPro:IPR000281"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR035472"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q8YAS2"
FT                   /protein_id="CAC98256.1"
FT                   /translation="MDFYEISSKTVASLTRNERILFDYVVKNMNLIKNQSIREVSAECF
FT                   VSTTTFLRFVRKLGFTGYSEFTTVLKFTLLGHTELKPSPFVVEQSDYREEYLKNIIESV
FT                   RVLEPSKIKKITKKLVNKPRIYFFAKGLSKHAAKYIKYLYTMSGFLVEFPEDYQYRQAV
FT                   LPHIGKDDLVFILTYGGHDIELIQTAQKLKSRNETPMLISITGADNNIIQNMSDINLYI
FT                   FTDEIEMNNLDITSRISTIAIMELILYQFMEDETSSF"
     MDFYEISSKT VASLTRNERI LFDYVVKNMN LIKNQSIREV SAECFVSTTT FLRFVRKLGF        60
     TGYSEFTTVL KFTLLGHTEL KPSPFVVEQS DYREEYLKNI IESVRVLEPS KIKKITKKLV       120
     NKPRIYFFAK GLSKHAAKYI KYLYTMSGFL VEFPEDYQYR QAVLPHIGKD DLVFILTYGG       180
     HDIELIQTAQ KLKSRNETPM LISITGADNN IIQNMSDINL YIFTDEIEMN NLDITSRIST       240
     IAIMELILYQ FMEDETSSF                                                    259
//

If you have problems or comments...

PBIL Back to PBIL home page