(data stored in SCRATCH3701 zone)

EMBL: AL591973.LMO0042

AL591973.LMO0042     Location/Qualifiers
FT   CDS             47335..47994
FT                   /transl_table=11
FT                   /gene="lmo0042"
FT                   /note="similar to E. coli DedA protein"
FT                   /db_xref="GOA:Q8YAS1"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="InterPro:IPR032818"
FT                   /db_xref="UniProtKB/TrEMBL:Q8YAS1"
FT                   /protein_id="CAC98257.1"
FT                   /translation="MDFITYIIDFILHIDQHLVEIINNFGIWTYIILFLIVFIETGLVV
FT                   FPFLPGDSLLFAAGALSVLDGSILHIVPLIITLWLAAVLGDTVNYHIGKKIGTSIPEDS
FT                   WFGKLINKEKMEKAEAFFNKHGGKTIFIARFMPFIRTFAPFVAGASRMNYRYFLNYNIL
FT                   GATVWVLLCTLAGYFFGNFPIVKDNFSLVVIGIIVVSVIPMVVSFIKSKMDKKSAE"
     MDFITYIIDF ILHIDQHLVE IINNFGIWTY IILFLIVFIE TGLVVFPFLP GDSLLFAAGA        60
     LSVLDGSILH IVPLIITLWL AAVLGDTVNY HIGKKIGTSI PEDSWFGKLI NKEKMEKAEA       120
     FFNKHGGKTI FIARFMPFIR TFAPFVAGAS RMNYRYFLNY NILGATVWVL LCTLAGYFFG       180
     NFPIVKDNFS LVVIGIIVVS VIPMVVSFIK SKMDKKSAE                              219
//

If you have problems or comments...

PBIL Back to PBIL home page