(data stored in SCRATCH3701 zone)

EMBL: AL591973.LMO0048

AL591973.LMO0048     Location/Qualifiers
FT   CDS             51775..52389
FT                   /transl_table=11
FT                   /gene="lmo0048"
FT                   /note="similar to Staphylococcus two-component sensor
FT                   histidine kinase AgrB"
FT                   /db_xref="GOA:Q8YAR6"
FT                   /db_xref="InterPro:IPR006741"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8YAR6"
FT                   /protein_id="CAC98263.1"
FT                   /translation="MSNFTAKVPLSERMADVLISKDRWKDDEEGYLKVKYGLEIILINV
FT                   MKFALVYGIALVTGLLLQTVTVHLSYLWLRRYSFGLHATKTLNCTLISLLMFVLAPFVF
FT                   QNIPSNNWIVLGTFGFILLNMFLFAPADTESLPLIGEEHRKTLKRKAMIGTLILTGIAL
FT                   LIPFAEMKTLIMVGSLFQVISINPLTYKLLKRRYRNYEKYE"
     MSNFTAKVPL SERMADVLIS KDRWKDDEEG YLKVKYGLEI ILINVMKFAL VYGIALVTGL        60
     LLQTVTVHLS YLWLRRYSFG LHATKTLNCT LISLLMFVLA PFVFQNIPSN NWIVLGTFGF       120
     ILLNMFLFAP ADTESLPLIG EEHRKTLKRK AMIGTLILTG IALLIPFAEM KTLIMVGSLF       180
     QVISINPLTY KLLKRRYRNY EKYE                                              204
//

If you have problems or comments...

PBIL Back to PBIL home page