(data stored in SCRATCH3701 zone)

EMBL: AL591973.LMO0050

AL591973.LMO0050     Location/Qualifiers
FT   CDS             52630..53925
FT                   /transl_table=11
FT                   /gene="lmo0050"
FT                   /note="similar to sensor histidine kinase (AgrC from
FT                   Staphylococcus)"
FT                   /db_xref="GOA:Q8YAR5"
FT                   /db_xref="InterPro:IPR032834"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q8YAR5"
FT                   /protein_id="CAC98265.1"
FT                   /translation="MFSILMAIIQITGIFIAIQILTNKVFSIKEGLVTIAIAMLAFPLF
FT                   TLVQYWSMIFVLIVFVSALYWKNKNVVVSASITLVVIILLTISDSIVGFILVPGLNFKY
FT                   DEIFNELLPTLIYCAGMLANLLVFSFLLRKLIEKVNISRFVEHRKYAYIIFSIVALTVL
FT                   AFYMNIYAGSIAGFDGSVLKINTLIFTGYTILLIVIVTVVINTATNELKVQNQKEQLEQ
FT                   LQDYVTTLESLHREMRVFRHDYVNILSTLVGYIDNNDMPGLKYYFENNIVPINKTIESN
FT                   NYKISLLQNIHVIELKGLLAVKLIRAQELKIDAILEVVEPIDKISMDSIDLCKVVGILL
FT                   DNAVEAALTCENPVIRIAFVKKGDSIIIVFANSLPVNMPPIYKIFEEGFSTKGEGRGLG
FT                   LASLREIMKKYSHVALDTKVTDREVIQELEIM"
     MFSILMAIIQ ITGIFIAIQI LTNKVFSIKE GLVTIAIAML AFPLFTLVQY WSMIFVLIVF        60
     VSALYWKNKN VVVSASITLV VIILLTISDS IVGFILVPGL NFKYDEIFNE LLPTLIYCAG       120
     MLANLLVFSF LLRKLIEKVN ISRFVEHRKY AYIIFSIVAL TVLAFYMNIY AGSIAGFDGS       180
     VLKINTLIFT GYTILLIVIV TVVINTATNE LKVQNQKEQL EQLQDYVTTL ESLHREMRVF       240
     RHDYVNILST LVGYIDNNDM PGLKYYFENN IVPINKTIES NNYKISLLQN IHVIELKGLL       300
     AVKLIRAQEL KIDAILEVVE PIDKISMDSI DLCKVVGILL DNAVEAALTC ENPVIRIAFV       360
     KKGDSIIIVF ANSLPVNMPP IYKIFEEGFS TKGEGRGLGL ASLREIMKKY SHVALDTKVT       420
     DREVIQELEI M                                                            431
//

If you have problems or comments...

PBIL Back to PBIL home page