(data stored in SCRATCH3701 zone)

EMBL: AL591973.LMO0051

AL591973.LMO0051     Location/Qualifiers
FT   CDS             53944..54672
FT                   /transl_table=11
FT                   /gene="lmo0051"
FT                   /note="similar to 2-components response regulator protein
FT                   (AgrA from Staphylococcus)"
FT                   /db_xref="GOA:Q8YAR4"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR007492"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:Q8YAR4"
FT                   /protein_id="CAC98266.1"
FT                   /translation="MLPVFICEDNRMQRERLTKYIEDYIMVEHFDMKLELSTGDPFELV
FT                   SRMPTHQGMGLYFLDIDLGQPDMNGFELAQEIRKFDPRGFIIFITTHAELSYMTFTYKV
FT                   EALDYIIKDDIDLLHDRVLACMKQAEERISNDQDMQKYFTFKVSDKKIIHELLDDILFF
FT                   ETAPTIHKVILHGKNRQVEFYGKLKNIEKMLDESFYRCHRSYIVNKKNIHELDTTKGVV
FT                   KMSNGENCYASSKLIKSLSL"
     MLPVFICEDN RMQRERLTKY IEDYIMVEHF DMKLELSTGD PFELVSRMPT HQGMGLYFLD        60
     IDLGQPDMNG FELAQEIRKF DPRGFIIFIT THAELSYMTF TYKVEALDYI IKDDIDLLHD       120
     RVLACMKQAE ERISNDQDMQ KYFTFKVSDK KIIHELLDDI LFFETAPTIH KVILHGKNRQ       180
     VEFYGKLKNI EKMLDESFYR CHRSYIVNKK NIHELDTTKG VVKMSNGENC YASSKLIKSL       240
     SL                                                                      242
//

If you have problems or comments...

PBIL Back to PBIL home page