(data stored in SCRATCH3701 zone)

EMBL: AL591973.LMO0052

AL591973.LMO0052     Location/Qualifiers
FT   CDS             54839..56812
FT                   /transl_table=11
FT                   /gene="lmo0052"
FT                   /note="highly similar to B. subtilis YybT protein"
FT                   /db_xref="GOA:Q8YAR3"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001667"
FT                   /db_xref="InterPro:IPR003156"
FT                   /db_xref="InterPro:IPR014528"
FT                   /db_xref="InterPro:IPR038763"
FT                   /db_xref="UniProtKB/TrEMBL:Q8YAR3"
FT                   /protein_id="CAC98267.1"
FT                   /translation="MSGYFQKRMLKYPLYGLIAATIILSVITFFFSWWLSALVVVGGII
FT                   LTVAMFYFEYRLNEDVQLYVSNLTYRIKRSEEEALVEMPMGILLYDEHYKIEWVNPFMS
FT                   KYFDKAELIGESLEEVGPEFLDVITGNDEKGIMSIAWRDHRFDTIVKRKERILYLYDRT
FT                   EYYDLNKKFQANKSVFAVIFLDNYDEWAQGMDDRRRSALNNLVTSMLTNWAREHRIYLK
FT                   RISTDRFMAFLTEEMLKRLEEEKFQILDRIRERTSKQNIPLTLSIGIGYKEDDLIQLAD
FT                   LAQSSLDLALGRGGDQVVIKQPEGKVRFYGGKTNPMEKRTRVRARVISQALQELITQSD
FT                   QVFVMGHRYPDMDVIGSSLGVMRIAEMNDRNAYVVVEPGKMSPDVKRLMNEIEEYPNVI
FT                   KNIVTPQVALENITEKSLLVVVDTHKPSMVINKELLDSATNVVVVDHHRRSEEFVGSPV
FT                   LVYIEPYASSTAELITELFEYQPDLEQVGKIEATALLSGIVVDTKNFTLRTGSRTFDAA
FT                   SYLRSLGADTILVQQFLKEDITTFTQRSRLVESLEIYHDGMAIATGHEDEEFGTVIAAQ
FT                   AADTMLSMEGVQASFVITLRPDKLIGISARSLGQINVQVIMEKLGGGGHLSNAATQLKD
FT                   VTIAEAEKQLISAIDAYWKGET"
     MSGYFQKRML KYPLYGLIAA TIILSVITFF FSWWLSALVV VGGIILTVAM FYFEYRLNED        60
     VQLYVSNLTY RIKRSEEEAL VEMPMGILLY DEHYKIEWVN PFMSKYFDKA ELIGESLEEV       120
     GPEFLDVITG NDEKGIMSIA WRDHRFDTIV KRKERILYLY DRTEYYDLNK KFQANKSVFA       180
     VIFLDNYDEW AQGMDDRRRS ALNNLVTSML TNWAREHRIY LKRISTDRFM AFLTEEMLKR       240
     LEEEKFQILD RIRERTSKQN IPLTLSIGIG YKEDDLIQLA DLAQSSLDLA LGRGGDQVVI       300
     KQPEGKVRFY GGKTNPMEKR TRVRARVISQ ALQELITQSD QVFVMGHRYP DMDVIGSSLG       360
     VMRIAEMNDR NAYVVVEPGK MSPDVKRLMN EIEEYPNVIK NIVTPQVALE NITEKSLLVV       420
     VDTHKPSMVI NKELLDSATN VVVVDHHRRS EEFVGSPVLV YIEPYASSTA ELITELFEYQ       480
     PDLEQVGKIE ATALLSGIVV DTKNFTLRTG SRTFDAASYL RSLGADTILV QQFLKEDITT       540
     FTQRSRLVES LEIYHDGMAI ATGHEDEEFG TVIAAQAADT MLSMEGVQAS FVITLRPDKL       600
     IGISARSLGQ INVQVIMEKL GGGGHLSNAA TQLKDVTIAE AEKQLISAID AYWKGET          657
//

If you have problems or comments...

PBIL Back to PBIL home page