(data stored in SCRATCH3701 zone)

EMBL: AL591973.LMO0056

AL591973.LMO0056     Location/Qualifiers
FT   CDS             60506..60799
FT                   /transl_table=11
FT                   /gene="lmo0056"
FT                   /note="similar to a small heat shock protein of Clostridium
FT                   acetobutylicum"
FT                   /db_xref="InterPro:IPR010310"
FT                   /db_xref="InterPro:IPR036689"
FT                   /db_xref="UniProtKB/TrEMBL:Q8YAR0"
FT                   /protein_id="CAC98271.1"
FT                   /translation="MSGQIRMSPSELRDRAKTYGQSGRDIEDILSRLSQLQEQLRSEWE
FT                   GQAFMRFDDQFEQLKPKVTEFANLMDQINDQLEKTANAVEEHDQQLSQNFGF"
     MSGQIRMSPS ELRDRAKTYG QSGRDIEDIL SRLSQLQEQL RSEWEGQAFM RFDDQFEQLK        60
     PKVTEFANLM DQINDQLEKT ANAVEEHDQQ LSQNFGF                                 97
//

If you have problems or comments...

PBIL Back to PBIL home page