(data stored in SCRATCH3701 zone)

EMBL: AL591973.LMO0057

AL591973.LMO0057     Location/Qualifiers
FT   CDS             60948..64154
FT                   /transl_table=11
FT                   /gene="lmo0057"
FT                   /note="similar to B. subtilis YueB protein"
FT                   /db_xref="GOA:Q8YAQ9"
FT                   /db_xref="InterPro:IPR023838"
FT                   /db_xref="UniProtKB/TrEMBL:Q8YAQ9"
FT                   /protein_id="CAC98272.1"
FT                   /translation="MKKVKWSILLFLVLAIFLSAGITYLALNQSSNKESKNNSEKTHKM
FT                   TIALVNEDQGDNFQGKQVEFGNQFVKSIEKDDTHEWYVVSRGVAESGLKRDVYNMMIVI
FT                   PSDFSEKAMSMTSSAPEKVTISYKVNDVGNSDLKAEAEKTAASVLEDFNSRIIDVYFAS
FT                   ILTTLQEAQDNIGTLVKEEKKYDAIYNKDVNNPLSSYTKQFKTVQDYTGTSKESFQGFQ
FT                   DIMKEFEESLNLSQKENEEHMKNMDAYTKTQEENAPFGAEFTENLSKFDGTLSAEDIRM
FT                   QTAALEQVNAKMTSEFQILENSNSLLSQTQALQSYIAETNARIDAVDAEIMGTLENDFR
FT                   TAVYNDLLRILQENEYSDKLNEIGLKDLTGEDINAGFNKMIVKEIQSLPTYNADQLASI
FT                   GLDEEMYKNVVTLSKEYYSNHRGAFSEGFSFTTDPKTLPTDTLKSDTINRLKSEGVALE
FT                   SSSYTVEGSDYPTEIILTLDENFTFSDVDCLVNGSSNPELVQQNAYGENGIKLSIQALG
FT                   STPAEIKITGKAKLREGVNVPLIGAVNWNATLQQYEKKEYSEMPTIPSELDPTTPDTSL
FT                   IVRKEPVPIKVTAPTYLNETKSSVKAITNTVKDYYKLQALFDLYYGIDASDSGQIPDFS
FT                   NYQVTLENSAKASSYYYIFNKEDVIGSFVNLTTDRFVADYTKKIKAFEKRIDDYKNTMA
FT                   EANSRSEDVTNRLNETTQEAINLNTNLALTLQNLESWREESKGLIEENGVVLEKSGEEA
FT                   TMALQLSSEFAGLLAESESLAGTSEGNLKSAEVVYKTFDAIDKEAKNIQQSGETLVKEA
FT                   STLSDDLSEKLEDDETFQKNFAKVMENSRVGDRQNENLYSFLSSPVDKMNAGTIVAGDK
FT                   SMPYFMILICTILAIFTSYVISHQEKKREQLNEFEKEMSLVFKNIPITFLAICVGIIEG
FT                   LIIGAISGFIFEVGEIGMFLWIGVCVLIMMTLVTAFSYLLRQFNMIGMSIILLVLSLYL
FT                   FLTDAVGLNIDNESIFATFRTFSPLQYMEYLLNGILSAQKDYIIVVYSLIGATVVFTGL
FT                   NLFVWHRSKEKVEEDDSDEI"
     MKKVKWSILL FLVLAIFLSA GITYLALNQS SNKESKNNSE KTHKMTIALV NEDQGDNFQG        60
     KQVEFGNQFV KSIEKDDTHE WYVVSRGVAE SGLKRDVYNM MIVIPSDFSE KAMSMTSSAP       120
     EKVTISYKVN DVGNSDLKAE AEKTAASVLE DFNSRIIDVY FASILTTLQE AQDNIGTLVK       180
     EEKKYDAIYN KDVNNPLSSY TKQFKTVQDY TGTSKESFQG FQDIMKEFEE SLNLSQKENE       240
     EHMKNMDAYT KTQEENAPFG AEFTENLSKF DGTLSAEDIR MQTAALEQVN AKMTSEFQIL       300
     ENSNSLLSQT QALQSYIAET NARIDAVDAE IMGTLENDFR TAVYNDLLRI LQENEYSDKL       360
     NEIGLKDLTG EDINAGFNKM IVKEIQSLPT YNADQLASIG LDEEMYKNVV TLSKEYYSNH       420
     RGAFSEGFSF TTDPKTLPTD TLKSDTINRL KSEGVALESS SYTVEGSDYP TEIILTLDEN       480
     FTFSDVDCLV NGSSNPELVQ QNAYGENGIK LSIQALGSTP AEIKITGKAK LREGVNVPLI       540
     GAVNWNATLQ QYEKKEYSEM PTIPSELDPT TPDTSLIVRK EPVPIKVTAP TYLNETKSSV       600
     KAITNTVKDY YKLQALFDLY YGIDASDSGQ IPDFSNYQVT LENSAKASSY YYIFNKEDVI       660
     GSFVNLTTDR FVADYTKKIK AFEKRIDDYK NTMAEANSRS EDVTNRLNET TQEAINLNTN       720
     LALTLQNLES WREESKGLIE ENGVVLEKSG EEATMALQLS SEFAGLLAES ESLAGTSEGN       780
     LKSAEVVYKT FDAIDKEAKN IQQSGETLVK EASTLSDDLS EKLEDDETFQ KNFAKVMENS       840
     RVGDRQNENL YSFLSSPVDK MNAGTIVAGD KSMPYFMILI CTILAIFTSY VISHQEKKRE       900
     QLNEFEKEMS LVFKNIPITF LAICVGIIEG LIIGAISGFI FEVGEIGMFL WIGVCVLIMM       960
     TLVTAFSYLL RQFNMIGMSI ILLVLSLYLF LTDAVGLNID NESIFATFRT FSPLQYMEYL      1020
     LNGILSAQKD YIIVVYSLIG ATVVFTGLNL FVWHRSKEKV EEDDSDEI                   1068
//

If you have problems or comments...

PBIL Back to PBIL home page