(data stored in SCRATCH3701 zone)

EMBL: AL591973.LMO0059

AL591973.LMO0059     Location/Qualifiers
FT   CDS             64677..64928
FT                   /transl_table=11
FT                   /gene="lmo0059"
FT                   /note="similar to B. subtilis YukD protein"
FT                   /db_xref="InterPro:IPR014921"
FT                   /db_xref="InterPro:IPR024962"
FT                   /db_xref="UniProtKB/TrEMBL:Q8YAQ7"
FT                   /protein_id="CAC98274.1"
FT                   /translation="MAKNTHMNVTVDFTNWGASKYDLRIPVHQPIKALIINLAETLKID
FT                   YKDLSKCTIKTTNKAILLSDDDKLTNFQIADGDILEIL"
     MAKNTHMNVT VDFTNWGASK YDLRIPVHQP IKALIINLAE TLKIDYKDLS KCTIKTTNKA        60
     ILLSDDDKLT NFQIADGDIL EIL                                                83
//

If you have problems or comments...

PBIL Back to PBIL home page