(data stored in SCRATCH3701 zone)

EMBL: AL591973.LMO0061

AL591973.LMO0061     Location/Qualifiers
FT   CDS             66160..70656
FT                   /transl_table=11
FT                   /gene="lmo0061"
FT                   /note="highly similar to B. subtilis YukA protein"
FT                   /db_xref="GOA:Q8YAQ5"
FT                   /db_xref="InterPro:IPR002543"
FT                   /db_xref="InterPro:IPR022206"
FT                   /db_xref="InterPro:IPR023839"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q8YAQ5"
FT                   /protein_id="CAC98276.1"
FT                   /translation="MNREALLIVSNGQQCHKNHLSPEKVVTIGNTIEHEITYPELAESI
FT                   EVKYDEGSWNAGTTALQANQAVNVENLAFYLCQDLHTQVYDVVTNISVTFGVGIENDVT
FT                   LDDTKSDFILLRDAKEKLFKLQVLNGEVYHNFSLVTEDCVLEPGDQLYTDGVTITIGKE
FT                   DISVLAVKNRVTSKLAPLFAADNSFGEDYPDYHRSPRIIYRAPEEKISMAKPSSKPSKP
FT                   TDGLIKIILPPLIMVAITVMISIFQPRGLYIIMTIAMSAVTITMAILNYIKSRKKYKID
FT                   SKQRVESYDLYLKRKTKELHETSEKQRHALTYHYPDVTELEKMALRVDSRIYEKTMFHH
FT                   DFLTFRVGRGDETSSFSVEFQQEEFSQEKDELVEEAVKIKGQYLSINEVPVATDLMHGP
FT                   VGYIGPRRLVLEQLQMLVMQTSLFHSYYDLQFITIFPEEEKADWDWMRWLPHANMRDVN
FT                   VRGFVYHERSRDQVLNSLYQILKERKQALTEQASKQEKLYFTPHYVVLITDEKLVLDHT
FT                   VMEFFNEDPSELGVSLVFVQDVMESLPEHVKTVVDIRDAKSGNIILEQGDLVNRAFVPD
FT                   HLPADFDKEVISRALAPLNHLQNLKNSIPESVTFLEMYGVERVEELNIAGRWAKNETYK
FT                   SLAVPLGLRGKDDIVQLNLHEKAHGPHGLVAGTTGSGKSEIIQSYIISLGVNFHPYEVA
FT                   FLLIDYKGGGMANLFKNMPHLLGTITNLDGAQSMRALASIKAELQKRQRLFGEHDVNHI
FT                   NQYQKLYKQGKATEPMPHLFLISDEFAELKSEQPEFMKELVSTARIGRSLGIHLILATQ
FT                   KPSGVVDDQIWSNSKFKLALKVQNASDSNEILKTPDAAEITLPGRSYLQVGNNEIYELF
FT                   QSAWSGADYVPDKESTDYIDTTIYAINDLGQYDILTEDLSGLDKKDDLTKLPSELDAVI
FT                   DHIHEYTEASGIEALPRPWLPPLEEQIFLPELHQVITDELWSGEKQPLQATIGFLDIPQ
FT                   MQAQEPLTIDLAKDGHLAVFSSPGYGKSTFLQTITMDLARQHNPERLHIYLLDLGTNGL
FT                   LPLKKLPHVADTIMVDEEIKIGKLIRRLTLELKERKQKLSKYGVASISMYEKASKEEVP
FT                   AILLVIDAFDSVGEAPYKDVFEKLIAQIAREGASVGIHLVMSAVRQNAIRVQMLASIKH
FT                   QIPLFMIEPGESRSIVGKTDLTIEELPGRGLVKLEEPTVFQTALPVCADGTLEIIEKIQ
FT                   AESEAMSSEWNGSRPAPIPMVPEVINMLEYLENKQVQKSLSEGKTPIAVDFEDVLPVNL
FT                   DVQTDGNTLVLTDNADVLERTMVSLTELIGQNMEVDIALYDNSSNRFQQYRNNVNIYAG
FT                   EETAMNSTSEQIVSVLEAREDGWKEIQRASNGEITLKMYVEELRPMYVLLTDSIYAAEQ
FT                   MSLEARKNMVRLIENGPKLGIYFVTGSQTGILYRARDEISGELRKQKTGILLGRISDQN
FT                   ILSLINNIYKEALLAPYEAYYIKQGQYEKIKLIAPNQ"
     MNREALLIVS NGQQCHKNHL SPEKVVTIGN TIEHEITYPE LAESIEVKYD EGSWNAGTTA        60
     LQANQAVNVE NLAFYLCQDL HTQVYDVVTN ISVTFGVGIE NDVTLDDTKS DFILLRDAKE       120
     KLFKLQVLNG EVYHNFSLVT EDCVLEPGDQ LYTDGVTITI GKEDISVLAV KNRVTSKLAP       180
     LFAADNSFGE DYPDYHRSPR IIYRAPEEKI SMAKPSSKPS KPTDGLIKII LPPLIMVAIT       240
     VMISIFQPRG LYIIMTIAMS AVTITMAILN YIKSRKKYKI DSKQRVESYD LYLKRKTKEL       300
     HETSEKQRHA LTYHYPDVTE LEKMALRVDS RIYEKTMFHH DFLTFRVGRG DETSSFSVEF       360
     QQEEFSQEKD ELVEEAVKIK GQYLSINEVP VATDLMHGPV GYIGPRRLVL EQLQMLVMQT       420
     SLFHSYYDLQ FITIFPEEEK ADWDWMRWLP HANMRDVNVR GFVYHERSRD QVLNSLYQIL       480
     KERKQALTEQ ASKQEKLYFT PHYVVLITDE KLVLDHTVME FFNEDPSELG VSLVFVQDVM       540
     ESLPEHVKTV VDIRDAKSGN IILEQGDLVN RAFVPDHLPA DFDKEVISRA LAPLNHLQNL       600
     KNSIPESVTF LEMYGVERVE ELNIAGRWAK NETYKSLAVP LGLRGKDDIV QLNLHEKAHG       660
     PHGLVAGTTG SGKSEIIQSY IISLGVNFHP YEVAFLLIDY KGGGMANLFK NMPHLLGTIT       720
     NLDGAQSMRA LASIKAELQK RQRLFGEHDV NHINQYQKLY KQGKATEPMP HLFLISDEFA       780
     ELKSEQPEFM KELVSTARIG RSLGIHLILA TQKPSGVVDD QIWSNSKFKL ALKVQNASDS       840
     NEILKTPDAA EITLPGRSYL QVGNNEIYEL FQSAWSGADY VPDKESTDYI DTTIYAINDL       900
     GQYDILTEDL SGLDKKDDLT KLPSELDAVI DHIHEYTEAS GIEALPRPWL PPLEEQIFLP       960
     ELHQVITDEL WSGEKQPLQA TIGFLDIPQM QAQEPLTIDL AKDGHLAVFS SPGYGKSTFL      1020
     QTITMDLARQ HNPERLHIYL LDLGTNGLLP LKKLPHVADT IMVDEEIKIG KLIRRLTLEL      1080
     KERKQKLSKY GVASISMYEK ASKEEVPAIL LVIDAFDSVG EAPYKDVFEK LIAQIAREGA      1140
     SVGIHLVMSA VRQNAIRVQM LASIKHQIPL FMIEPGESRS IVGKTDLTIE ELPGRGLVKL      1200
     EEPTVFQTAL PVCADGTLEI IEKIQAESEA MSSEWNGSRP APIPMVPEVI NMLEYLENKQ      1260
     VQKSLSEGKT PIAVDFEDVL PVNLDVQTDG NTLVLTDNAD VLERTMVSLT ELIGQNMEVD      1320
     IALYDNSSNR FQQYRNNVNI YAGEETAMNS TSEQIVSVLE AREDGWKEIQ RASNGEITLK      1380
     MYVEELRPMY VLLTDSIYAA EQMSLEARKN MVRLIENGPK LGIYFVTGSQ TGILYRARDE      1440
     ISGELRKQKT GILLGRISDQ NILSLINNIY KEALLAPYEA YYIKQGQYEK IKLIAPNQ        1498
//

If you have problems or comments...

PBIL Back to PBIL home page