(data stored in SCRATCH3701 zone)

EMBL: AL591973.LMO0076

AL591973.LMO0076     Location/Qualifiers
FT   CDS             79817..80869
FT                   /transl_table=11
FT                   /gene="lmo0076"
FT                   /note="similar to E. coli Ada protein (O6-methylguanine-DNA
FT                   methyltransferase)"
FT                   /db_xref="GOA:Q8YAP1"
FT                   /db_xref="InterPro:IPR001497"
FT                   /db_xref="InterPro:IPR004026"
FT                   /db_xref="InterPro:IPR014048"
FT                   /db_xref="InterPro:IPR016221"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR035451"
FT                   /db_xref="InterPro:IPR036217"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036631"
FT                   /db_xref="UniProtKB/TrEMBL:Q8YAP1"
FT                   /protein_id="CAC98291.1"
FT                   /translation="MITNQRDIDKYYDMLVEKNSNYEGVFFVGVKTTGILCRPTCPAKK
FT                   PLKENCEFFSTAKEALLASYRPCKRCEPLSNPTKLSPAVKLLVDAIEKNPEKKWTDKDF
FT                   DDLSISANTARRQFKKQFGMTFIEYARSRRLGLAFKHIRGGNSIINAQLDSGYESGNGF
FT                   RDAFSKTMGEVPHKSKDITILYSAWLETKLGSMLAISDDDSLLLLEFVDRKGLETEIKK
FT                   LRMRLNAAITPEKTIIIQQIEAELAQYFNGELIDFKTPIRYIGSDFQENVWEELRRIPI
FT                   GETISYKGLAEKLGRSTASRAVARANGANQLSLIVPCHRVINTNGALGGYGGGLARKEW
FT                   LIKHEKMVPK"
     MITNQRDIDK YYDMLVEKNS NYEGVFFVGV KTTGILCRPT CPAKKPLKEN CEFFSTAKEA        60
     LLASYRPCKR CEPLSNPTKL SPAVKLLVDA IEKNPEKKWT DKDFDDLSIS ANTARRQFKK       120
     QFGMTFIEYA RSRRLGLAFK HIRGGNSIIN AQLDSGYESG NGFRDAFSKT MGEVPHKSKD       180
     ITILYSAWLE TKLGSMLAIS DDDSLLLLEF VDRKGLETEI KKLRMRLNAA ITPEKTIIIQ       240
     QIEAELAQYF NGELIDFKTP IRYIGSDFQE NVWEELRRIP IGETISYKGL AEKLGRSTAS       300
     RAVARANGAN QLSLIVPCHR VINTNGALGG YGGGLARKEW LIKHEKMVPK                  350
//

If you have problems or comments...

PBIL Back to PBIL home page