(data stored in SCRATCH3701 zone)

EMBL: AL591973.LMO0077

AL591973.LMO0077     Location/Qualifiers
FT   CDS             complement(80892..81530)
FT                   /transl_table=11
FT                   /gene="lmo0077"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="InterPro:IPR001646"
FT                   /db_xref="UniProtKB/TrEMBL:Q8YAP0"
FT                   /protein_id="CAC98292.1"
FT                   /translation="MKKITAPRIPDGDLTVYPNDTYFIEDIGEVSEQIFRKTTLTGEIF
FT                   EHFHLETIIFDGCVFDSVSLVSANLTDVVFKNCDLSNLDLMGAIIHRVRFENCKLIGMN
FT                   FSDATLRNCVFVDCYADYVAFRYANLKWVAFEAGAYTNSDFSGAQLVDTYLERLDLNKA
FT                   QFLNCALNGIDLSSCIFESITAMPQDLKGMSIDFSHAPALMPLFGIRVK"
     MKKITAPRIP DGDLTVYPND TYFIEDIGEV SEQIFRKTTL TGEIFEHFHL ETIIFDGCVF        60
     DSVSLVSANL TDVVFKNCDL SNLDLMGAII HRVRFENCKL IGMNFSDATL RNCVFVDCYA       120
     DYVAFRYANL KWVAFEAGAY TNSDFSGAQL VDTYLERLDL NKAQFLNCAL NGIDLSSCIF       180
     ESITAMPQDL KGMSIDFSHA PALMPLFGIR VK                                     212
//

If you have problems or comments...

PBIL Back to PBIL home page