(data stored in SCRATCH3701 zone)

EMBL: AL591973.LMO0107

AL591973.LMO0107     Location/Qualifiers
FT   CDS             complement(113313..115094)
FT                   /transl_table=11
FT                   /gene="lmo0107"
FT                   /note="similar to ABC transporter, ATP-binding protein"
FT                   /db_xref="GOA:Q8YAL1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:Q8YAL1"
FT                   /protein_id="CAC98322.1"
FT                   /translation="MARNKFDIDEELETAFSAAHLKRILVYVKPYQKSIYITLFVILLA
FT                   NVATMIGPYLTKIVIDDTIPNKNMTQLFWIAVIFIVSVIVTGLCMRYRIRSITLIGQDI
FT                   LKDMRTAIFGHLQKLPFSYFDSRPHGKILIRVVNYINMLSDLLSNGLINLISDILSVIV
FT                   TLGFMLMIDPVLTLYSLALIPVLFVIVMVIKTAQRKAYQVLSNKQSNMNAYIHESIAGI
FT                   KVTQSFSREEENFEIFTEVSNEYRRSWMKAVKIQFLLWPGVQNIAVMTTCLIYFVGIKG
FT                   YGVDVSTGTLIAFIGYVGNFWNPVINIGNFYNSLITATTYLERIFETMDVEPDIKDIPN
FT                   AKKMPPIVGNVDFKDVYFRYEEGVDILKGINFHVDAGESIALVGPTGAGKTTIINLLSR
FT                   FYNINSGEILVDGENVEEVTLRSLRSQMGVMLQDTFIFSGTIIENIRYGKLDATEEEII
FT                   AAAKVVRAHDFISGLKDGYYTEVKERGSTLSAGQRQLISFARALLADPKILILDEATSS
FT                   IDTQTEILLQEGLERLLEGRTSFIIAHRLSTIKNSSRIFYIDNGRIQEAGSHEELMAQH
FT                   GYYYNLYQSQFDMLQAL"
     MARNKFDIDE ELETAFSAAH LKRILVYVKP YQKSIYITLF VILLANVATM IGPYLTKIVI        60
     DDTIPNKNMT QLFWIAVIFI VSVIVTGLCM RYRIRSITLI GQDILKDMRT AIFGHLQKLP       120
     FSYFDSRPHG KILIRVVNYI NMLSDLLSNG LINLISDILS VIVTLGFMLM IDPVLTLYSL       180
     ALIPVLFVIV MVIKTAQRKA YQVLSNKQSN MNAYIHESIA GIKVTQSFSR EEENFEIFTE       240
     VSNEYRRSWM KAVKIQFLLW PGVQNIAVMT TCLIYFVGIK GYGVDVSTGT LIAFIGYVGN       300
     FWNPVINIGN FYNSLITATT YLERIFETMD VEPDIKDIPN AKKMPPIVGN VDFKDVYFRY       360
     EEGVDILKGI NFHVDAGESI ALVGPTGAGK TTIINLLSRF YNINSGEILV DGENVEEVTL       420
     RSLRSQMGVM LQDTFIFSGT IIENIRYGKL DATEEEIIAA AKVVRAHDFI SGLKDGYYTE       480
     VKERGSTLSA GQRQLISFAR ALLADPKILI LDEATSSIDT QTEILLQEGL ERLLEGRTSF       540
     IIAHRLSTIK NSSRIFYIDN GRIQEAGSHE ELMAQHGYYY NLYQSQFDML QAL              593
//

If you have problems or comments...

PBIL Back to PBIL home page