(data stored in SCRATCH3701 zone)

EMBL: AL591973.LMO0108

AL591973.LMO0108     Location/Qualifiers
FT   CDS             complement(115087..116829)
FT                   /transl_table=11
FT                   /gene="lmo0108"
FT                   /note="similar to ABC transporter, ATP-binding protein"
FT                   /db_xref="GOA:Q8YAL0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:Q8YAL0"
FT                   /protein_id="CAC98323.1"
FT                   /translation="MESMKWIWQYVRKYRLLMIGVFILIFIASGISIIYPLLGGKVIDD
FT                   VVYQNKTNLLIPLLLIMIISTIIRTICRYTYQIMCERIGQNSLFRIREDLYKKLQSLDF
FT                   DFFNNTRVGDIMARMTGDTDAIRHFVSWVSYNILENVFLFSFAIIIMATIDWKLTLALV
FT                   IVTPLIAVLTMKMSSKAQPVFYEIRESFSRLNSMVEENISGNRVVKAFAREDFEMKKFH
FT                   EHNEDFKKRNLDSADVSRTYLPVLDSLAGMLVVITLIFGGYLVIKGQMTLGDLVAFNGF
FT                   LWMLNGPMRMSGWLINDVQRFIASSFKIQDMMVTDAKIPIHAEKPAPSLQGHVEFKNVS
FT                   FHFEDDPNTDVLKNISLKASPGQTIAILGETGAGKSTLVNLICRFYDPTSGEILIDGVD
FT                   ARKWHVRELRNHIATVMQDIFLFSDTIEGNIAFGAPDATMEDVRRMARIADADHFIETM
FT                   PESYDTIVGERGVGLSGGQKQRISLARALLKNPSILILDDTTSAVDMETEVKIQGELKK
FT                   ITENTTTFIIAHRISSVKEADEILILNHGEIIERGTHTSLLAEKGYYFDIYNKQLGTEA
FT                   NVNG"
     MESMKWIWQY VRKYRLLMIG VFILIFIASG ISIIYPLLGG KVIDDVVYQN KTNLLIPLLL        60
     IMIISTIIRT ICRYTYQIMC ERIGQNSLFR IREDLYKKLQ SLDFDFFNNT RVGDIMARMT       120
     GDTDAIRHFV SWVSYNILEN VFLFSFAIII MATIDWKLTL ALVIVTPLIA VLTMKMSSKA       180
     QPVFYEIRES FSRLNSMVEE NISGNRVVKA FAREDFEMKK FHEHNEDFKK RNLDSADVSR       240
     TYLPVLDSLA GMLVVITLIF GGYLVIKGQM TLGDLVAFNG FLWMLNGPMR MSGWLINDVQ       300
     RFIASSFKIQ DMMVTDAKIP IHAEKPAPSL QGHVEFKNVS FHFEDDPNTD VLKNISLKAS       360
     PGQTIAILGE TGAGKSTLVN LICRFYDPTS GEILIDGVDA RKWHVRELRN HIATVMQDIF       420
     LFSDTIEGNI AFGAPDATME DVRRMARIAD ADHFIETMPE SYDTIVGERG VGLSGGQKQR       480
     ISLARALLKN PSILILDDTT SAVDMETEVK IQGELKKITE NTTTFIIAHR ISSVKEADEI       540
     LILNHGEIIE RGTHTSLLAE KGYYFDIYNK QLGTEANVNG                             580
//

If you have problems or comments...

PBIL Back to PBIL home page