(data stored in SCRATCH3701 zone)

EMBL: AL591973.LMO0113

AL591973.LMO0113     Location/Qualifiers
FT   CDS             complement(120654..121106)
FT                   /transl_table=11
FT                   /gene="lmo0113"
FT                   /note="similar to protein gp35 from Bacteriophage A118"
FT                   /db_xref="InterPro:IPR010359"
FT                   /db_xref="UniProtKB/TrEMBL:Q8YAK5"
FT                   /protein_id="CAC98328.1"
FT                   /translation="MYEKLVNKYQDEVTIREEKMPYKLPGLYLNGMIFISKDQSSIEKG
FT                   CVLVEELMHYKYTVGNITKQETIMDKKQEIFARRKGYEELIPLDDIIACFYLGLREYFE
FT                   VAEFLEVTEEFLRHTVSHYAEKYGPMYDYGGYFINFGNSIDVYKKF"
     MYEKLVNKYQ DEVTIREEKM PYKLPGLYLN GMIFISKDQS SIEKGCVLVE ELMHYKYTVG        60
     NITKQETIMD KKQEIFARRK GYEELIPLDD IIACFYLGLR EYFEVAEFLE VTEEFLRHTV       120
     SHYAEKYGPM YDYGGYFINF GNSIDVYKKF                                        150
//

If you have problems or comments...

PBIL Back to PBIL home page