(data stored in SCRATCH3701 zone)

EMBL: AL591973.LMO0123

AL591973.LMO0123     Location/Qualifiers
FT   CDS             127188..128324
FT                   /transl_table=11
FT                   /gene="lmo0123"
FT                   /note="similar to protein gp18 from Bacteriophage A118"
FT                   /db_xref="InterPro:IPR010572"
FT                   /db_xref="UniProtKB/TrEMBL:Q8YAK1"
FT                   /protein_id="CAC98338.1"
FT                   /translation="MDYVIIQSMDKEVEEILTDIDYGSFSYDYEKNTSRAISFTVNKTK
FT                   QNAAIFDLVGNEAILTYQGQQFVIKKCTPKSIGGTLSKQITAQHICYTVQDHVQYNVKS
FT                   GRKKYSIQTVLEFALQDNVLGFSYEIQGSFPLVELEDLGNKNGLELVNLCLEEFGAILF
FT                   ADNKKLYFYDEKSWYVKTEKQFRYLYNTEEVSVDTNTDNLKTEIKCYGKQKENADKLTG
FT                   DNKYMAVVTYTSPNEAIYGKRMANAKSDDKITNNDDLLIFAKKQILDVPETALTISYKG
FT                   KEPVSERDVWYFIHEPMGFETEVKVTKIKSSHPWSKKFQEIGFSNSRRDMVRIQTQIAN
FT                   QVKKASVDTNKINSFSSIAMNAYDSRILTEVVGVVDGD"
     MDYVIIQSMD KEVEEILTDI DYGSFSYDYE KNTSRAISFT VNKTKQNAAI FDLVGNEAIL        60
     TYQGQQFVIK KCTPKSIGGT LSKQITAQHI CYTVQDHVQY NVKSGRKKYS IQTVLEFALQ       120
     DNVLGFSYEI QGSFPLVELE DLGNKNGLEL VNLCLEEFGA ILFADNKKLY FYDEKSWYVK       180
     TEKQFRYLYN TEEVSVDTNT DNLKTEIKCY GKQKENADKL TGDNKYMAVV TYTSPNEAIY       240
     GKRMANAKSD DKITNNDDLL IFAKKQILDV PETALTISYK GKEPVSERDV WYFIHEPMGF       300
     ETEVKVTKIK SSHPWSKKFQ EIGFSNSRRD MVRIQTQIAN QVKKASVDTN KINSFSSIAM       360
     NAYDSRILTE VVGVVDGD                                                     378
//

If you have problems or comments...

PBIL Back to PBIL home page