(data stored in SCRATCH3701 zone)

EMBL: AL591973.LMO0127

AL591973.LMO0127     Location/Qualifiers
FT   CDS             129694..130230
FT                   /transl_table=11
FT                   /gene="lmo0127"
FT                   /note="weakly similar to protein gp20 from Bacteriophage
FT                   A118"
FT                   /db_xref="UniProtKB/TrEMBL:Q8YAJ7"
FT                   /protein_id="CAC98342.1"
FT                   /translation="MTKIVKMSEKNEHGTLEQFYPETHAEAVKGLVSVSEEEKTIWDQK
FT                   ESTAGAEQKANTALNSAKDYVDTIGEGTVIFKGANLMGAGQSFKWDASKLKFGMTLLFS
FT                   RYDAANNTPQDYYYHSVFLSKAQLVELAGKGILVQMPSTTYGDRKYLYVSTTGLSGHFD
FT                   NSNYAAWALRQVTIM"
     MTKIVKMSEK NEHGTLEQFY PETHAEAVKG LVSVSEEEKT IWDQKESTAG AEQKANTALN        60
     SAKDYVDTIG EGTVIFKGAN LMGAGQSFKW DASKLKFGMT LLFSRYDAAN NTPQDYYYHS       120
     VFLSKAQLVE LAGKGILVQM PSTTYGDRKY LYVSTTGLSG HFDNSNYAAW ALRQVTIM         178
//

If you have problems or comments...

PBIL Back to PBIL home page