(data stored in SCRATCH3701 zone)

EMBL: AL591973.LMO0128

AL591973.LMO0128     Location/Qualifiers
FT   CDS             130249..130671
FT                   /transl_table=11
FT                   /gene="lmo0128"
FT                   /note="similar to a protein from Bacteriophage phi-105 (ORF
FT                   45)"
FT                   /db_xref="GOA:P58702"
FT                   /db_xref="InterPro:IPR006480"
FT                   /db_xref="UniProtKB/Swiss-Prot:P58702"
FT                   /protein_id="CAC98343.1"
FT                   /translation="MEVILKFGILGFGAIFGYLFGEVDLLVKVLVCFIVADYISGLLAS
FT                   GYLGELSSKMGFKGIAKKIAILILVAIAHQIDLILGTHNTTRDAVIFFYLANELISILE
FT                   NFVRMGMKVPEVLKNLILIFDAKSGEDEEKHDKDMD"
     MEVILKFGIL GFGAIFGYLF GEVDLLVKVL VCFIVADYIS GLLASGYLGE LSSKMGFKGI        60
     AKKIAILILV AIAHQIDLIL GTHNTTRDAV IFFYLANELI SILENFVRMG MKVPEVLKNL       120
     ILIFDAKSGE DEEKHDKDMD                                                   140
//

If you have problems or comments...

PBIL Back to PBIL home page