(data stored in SCRATCH3701 zone)

EMBL: AL591973.LMO0130

AL591973.LMO0130     Location/Qualifiers
FT   CDS             complement(131419..133773)
FT                   /transl_table=11
FT                   /gene="lmo0130"
FT                   /note="similar to 5'-nucleotidase, putative peptidoglycan
FT                   bound protein (LPXTG motif)"
FT                   /db_xref="GOA:Q8YAJ5"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR006146"
FT                   /db_xref="InterPro:IPR006179"
FT                   /db_xref="InterPro:IPR008334"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="InterPro:IPR036907"
FT                   /db_xref="InterPro:IPR041498"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8YAJ5"
FT                   /protein_id="CAC98345.1"
FT                   /translation="MKVNKFFKKTTHVLLVAGLTIGLTAPFTGTTAQAAADTVPIQILG
FT                   INDFHGALETASKDASGSPIGGADYLATNLDNATNSFLQANPGATTDNAIRVQAGDMVG
FT                   ASPAVSGLLQDEPTMKVLQKMNFEVGTLGNHEFDEGLPEYKRILDGVSTNKFGPIVEAY
FT                   PRVKSDMKIVAANVVNKGTNTVAEGFLPYYVKEIDGVKVGFIGIVTTEIPNLVLANHIK
FT                   DYDFLDEAETIVKYSAELRGQGVNAIVVLSHVPALSTGNPNTGTKQDVAGEAANMMTKA
FT                   NELDPNNSVDLVLAGHNHQYTNGLVGKTRIVQSYNNGKAFSDVTGELDKTTGDFVSPPD
FT                   AKITYNTRSVTPNADITAVTEDAKSRIEGVINETIGLANKDVISRDTNPDNKAIDDKES
FT                   ELGNMITDAQRYMANKAGADVDFAMTNNGGIRSDLTTRLANGQNEITWGAAQAVQPFGN
FT                   ILQVVEMTGADILEALNQQYLSNQTYFLQISGLKYTFTDTDDLDHAYKVASVTTEDGTP
FT                   LKTDQKYKVVINDFLFGGGDGFSAFKKANLVTAIDPDTETFINYIKDQKAAGKVITAQK
FT                   EGRKVYKSQAEIDKETKDAAIKAIKEATKINKLAEKDKTLTGTTLPGATVSVQKATANA
FT                   RMALAAGPNATADANGKFSVDVTSLNLKKGDQITTTITDPNGYSTTFQATVQAAATTPP
FT                   DNGNGGTDNGNGNGNNGGTDGNGGTNNGNGSGTNGGTTTTEDPTTTTSNTSTTGTSSNT
FT                   SLPTTGDTAGLATVFGVILTTTALYVLRKRS"
     MKVNKFFKKT THVLLVAGLT IGLTAPFTGT TAQAAADTVP IQILGINDFH GALETASKDA        60
     SGSPIGGADY LATNLDNATN SFLQANPGAT TDNAIRVQAG DMVGASPAVS GLLQDEPTMK       120
     VLQKMNFEVG TLGNHEFDEG LPEYKRILDG VSTNKFGPIV EAYPRVKSDM KIVAANVVNK       180
     GTNTVAEGFL PYYVKEIDGV KVGFIGIVTT EIPNLVLANH IKDYDFLDEA ETIVKYSAEL       240
     RGQGVNAIVV LSHVPALSTG NPNTGTKQDV AGEAANMMTK ANELDPNNSV DLVLAGHNHQ       300
     YTNGLVGKTR IVQSYNNGKA FSDVTGELDK TTGDFVSPPD AKITYNTRSV TPNADITAVT       360
     EDAKSRIEGV INETIGLANK DVISRDTNPD NKAIDDKESE LGNMITDAQR YMANKAGADV       420
     DFAMTNNGGI RSDLTTRLAN GQNEITWGAA QAVQPFGNIL QVVEMTGADI LEALNQQYLS       480
     NQTYFLQISG LKYTFTDTDD LDHAYKVASV TTEDGTPLKT DQKYKVVIND FLFGGGDGFS       540
     AFKKANLVTA IDPDTETFIN YIKDQKAAGK VITAQKEGRK VYKSQAEIDK ETKDAAIKAI       600
     KEATKINKLA EKDKTLTGTT LPGATVSVQK ATANARMALA AGPNATADAN GKFSVDVTSL       660
     NLKKGDQITT TITDPNGYST TFQATVQAAA TTPPDNGNGG TDNGNGNGNN GGTDGNGGTN       720
     NGNGSGTNGG TTTTEDPTTT TSNTSTTGTS SNTSLPTTGD TAGLATVFGV ILTTTALYVL       780
     RKRS                                                                    784
//

If you have problems or comments...

PBIL Back to PBIL home page