(data stored in SCRATCH3701 zone)

EMBL: AL591973.LMO0131

AL591973.LMO0131     Location/Qualifiers
FT   CDS             133961..134710
FT                   /transl_table=11
FT                   /gene="lmo0131"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="PDB:4Q6J"
FT                   /db_xref="UniProtKB/TrEMBL:Q8YAJ4"
FT                   /protein_id="CAC98346.1"
FT                   /translation="MDISSTEIWDAIRRNSYLLYYQPKVDAKTNKIIGFEGLVRLKTAT
FT                   TILAPIDFFDDIVLLNATREMQDFVAETAIKQINQLGGRFSISINIPAHYVASSTYMTF
FT                   LHDYVKEHLKYPECLEIEIIERGEITELAIADKNLRKIKDLGVKVSMDDFGKGYSSLAY
FT                   LRSLPIDIVKTDMSFIALLKTDRKQQIIIRAIVNLCHDLGGKVVTEGVEDMEQVEKLRE
FT                   MKVDYFQGYYFSRPLPMEEIKQKYSIV"
     MDISSTEIWD AIRRNSYLLY YQPKVDAKTN KIIGFEGLVR LKTATTILAP IDFFDDIVLL        60
     NATREMQDFV AETAIKQINQ LGGRFSISIN IPAHYVASST YMTFLHDYVK EHLKYPECLE       120
     IEIIERGEIT ELAIADKNLR KIKDLGVKVS MDDFGKGYSS LAYLRSLPID IVKTDMSFIA       180
     LLKTDRKQQI IIRAIVNLCH DLGGKVVTEG VEDMEQVEKL REMKVDYFQG YYFSRPLPME       240
     EIKQKYSIV                                                               249
//

If you have problems or comments...

PBIL Back to PBIL home page