(data stored in SCRATCH3701 zone)

EMBL: AL591973.LMO0133

AL591973.LMO0133     Location/Qualifiers
FT   CDS             136469..136702
FT                   /transl_table=11
FT                   /gene="lmo0133"
FT                   /note="similar to E. coli YjdI protein"
FT                   /db_xref="InterPro:IPR010693"
FT                   /db_xref="UniProtKB/TrEMBL:Q8YAJ2"
FT                   /protein_id="CAC98348.1"
FT                   /translation="MDEETLLERGYRKYRGADVDIYFNTNVCEHSGNCVKGNVELFNLD
FT                   RKPWIMPDNVSKEEAKRVIHTCPSGALQYIEK"
     MDEETLLERG YRKYRGADVD IYFNTNVCEH SGNCVKGNVE LFNLDRKPWI MPDNVSKEEA        60
     KRVIHTCPSG ALQYIEK                                                       77
//

If you have problems or comments...

PBIL Back to PBIL home page