(data stored in SCRATCH3701 zone)

EMBL: AL591973.LMO0134

AL591973.LMO0134     Location/Qualifiers
FT   CDS             136714..136992
FT                   /transl_table=11
FT                   /gene="lmo0134"
FT                   /note="similar to E. coli YjdJ protein"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR031165"
FT                   /db_xref="UniProtKB/TrEMBL:Q8YAJ1"
FT                   /protein_id="CAC98349.1"
FT                   /translation="MEYKNGENRIYAVNDEGVEVGEVTFVPTGEDMFIIDHTGVDDAAR
FT                   GQGIAQELVKRAVEKAKSEGKKIVPLCPFAKAEFSKKPEYQEVEASK"
     MEYKNGENRI YAVNDEGVEV GEVTFVPTGE DMFIIDHTGV DDAARGQGIA QELVKRAVEK        60
     AKSEGKKIVP LCPFAKAEFS KKPEYQEVEA SK                                      92
//

If you have problems or comments...

PBIL Back to PBIL home page