(data stored in SCRATCH3701 zone)

EMBL: AL591973.LMO0136

AL591973.LMO0136     Location/Qualifiers
FT   CDS             138999..139949
FT                   /transl_table=11
FT                   /gene="lmo0136"
FT                   /note="similar to oligopeptide ABC transporter, permease
FT                   protein"
FT                   /db_xref="GOA:Q92FC3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q92FC3"
FT                   /protein_id="CAC98351.1"
FT                   /translation="MLKTIIKRVLQIIPMLFIISIISFALIKLAPGDPVNSFVTPDMNP
FT                   DDVERIRQSLGLDQPIYVQYFIWLGNLLQGNLGYSIVNSQPVLQQILERIPATLGLVGT
FT                   SLVLTLLLSIPLGLVAANYENTWIDKVLNGISYIGISIPIFWFGMILIDVFSIQLGWLP
FT                   SLGMRTIGVDSFWDMAEHAILPVITLTFQGCAAYYRYVRSNTINQLKEEYVLFGYAKGL
FT                   SKVQIMGHHVLKNSLLPVITLLGMSLPQVITGAFITESIFSWPGMGSLGINAIFQLDYP
FT                   VIMAITLFSALLLIIGNLLADLAYMIVDPRIREMG"
     MLKTIIKRVL QIIPMLFIIS IISFALIKLA PGDPVNSFVT PDMNPDDVER IRQSLGLDQP        60
     IYVQYFIWLG NLLQGNLGYS IVNSQPVLQQ ILERIPATLG LVGTSLVLTL LLSIPLGLVA       120
     ANYENTWIDK VLNGISYIGI SIPIFWFGMI LIDVFSIQLG WLPSLGMRTI GVDSFWDMAE       180
     HAILPVITLT FQGCAAYYRY VRSNTINQLK EEYVLFGYAK GLSKVQIMGH HVLKNSLLPV       240
     ITLLGMSLPQ VITGAFITES IFSWPGMGSL GINAIFQLDY PVIMAITLFS ALLLIIGNLL       300
     ADLAYMIVDP RIREMG                                                       316
//

If you have problems or comments...

PBIL Back to PBIL home page