(data stored in SCRATCH3701 zone)

EMBL: AL591973.LMO0137

AL591973.LMO0137     Location/Qualifiers
FT   CDS             139960..140853
FT                   /transl_table=11
FT                   /gene="lmo0137"
FT                   /note="similar to oligopeptide ABC transporter, permease
FT                   protein"
FT                   /db_xref="GOA:Q8YAI9"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR025966"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q8YAI9"
FT                   /protein_id="CAC98352.1"
FT                   /translation="MRLDFSKKTMQDFERDAEVVHATRERSFWRFMLADRRAVFATSVL
FT                   ILITVACIFAFLSPYDPNALSVQDKLMPPNSSHWFGTDDHGRDYLTRVLYGGRVSLLVG
FT                   VFAMMIAVVVGTLAGTVSGYFGGFIDNIVMRFLDIFMSIPSFFLLMILNAYLKPGISNI
FT                   IIIIGLLSWMEVARIVRAETLTLKEREFILYSKSSGGGFFHIMFKHIIPNAMPSIVVAA
FT                   SLNVATAILTESALSFLGLGVQQPNASWGSMLNNAQGYVGEATYLALFPGLLILMTILS
FT                   FNVLGDVLRKGLSRRY"
     MRLDFSKKTM QDFERDAEVV HATRERSFWR FMLADRRAVF ATSVLILITV ACIFAFLSPY        60
     DPNALSVQDK LMPPNSSHWF GTDDHGRDYL TRVLYGGRVS LLVGVFAMMI AVVVGTLAGT       120
     VSGYFGGFID NIVMRFLDIF MSIPSFFLLM ILNAYLKPGI SNIIIIIGLL SWMEVARIVR       180
     AETLTLKERE FILYSKSSGG GFFHIMFKHI IPNAMPSIVV AASLNVATAI LTESALSFLG       240
     LGVQQPNASW GSMLNNAQGY VGEATYLALF PGLLILMTIL SFNVLGDVLR KGLSRRY          297
//

If you have problems or comments...

PBIL Back to PBIL home page