(data stored in SCRATCH3701 zone)

EMBL: AL591973.LMO0146

AL591973.LMO0146     Location/Qualifiers
FT   CDS             145354..145560
FT                   /transl_table=11
FT                   /gene="lmo0146"
FT                   /note="hypothetical protein"
FT                   /db_xref="InterPro:IPR028148"
FT                   /db_xref="UniProtKB/TrEMBL:Q8YAI0"
FT                   /protein_id="CAC98361.1"
FT                   /translation="MKFDLENGYVVKADGEMLVGGKFVVFKDSMKNWEPPYENKKLSES
FT                   EVQEIIQQVKQSTNENTVQISFE"
     MKFDLENGYV VKADGEMLVG GKFVVFKDSM KNWEPPYENK KLSESEVQEI IQQVKQSTNE        60
     NTVQISFE                                                                 68
//

If you have problems or comments...

PBIL Back to PBIL home page