(data stored in SCRATCH3701 zone)

EMBL: AL591973.LMO0152

AL591973.LMO0152     Location/Qualifiers
FT   CDS             complement(148354..150009)
FT                   /transl_table=11
FT                   /gene="lmo0152"
FT                   /note="similar to oligopeptide ABC transporter-binding
FT                   protein"
FT                   /db_xref="GOA:Q8YAH4"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:Q8YAH4"
FT                   /protein_id="CAC98367.1"
FT                   /translation="MHFLKKTLPIFAILTVLLLTACGNDNEKSTTKTSPDKIKFLETSE
FT                   LLTLNTTAEEDFASFTAQNQVFEGLYTLDQKDNFVPGVADGMPEISTDQTKYTIKLKKN
FT                   AKWSDGSQVTADDFVYAWRRAVDPKTAPGYSALFKDSIKNATEINEGKLPVTDLGVVAT
FT                   DPTTLEITLKKPVPYFISLLSFETFFPQKESYVKKQGDKYGTDSAHTLYNGPFVMKDWG
FT                   GNITNKWTYAKNDQYWDKDNVKVNEIDVQVAKDINAGVNLYNTNEADRVPLSGDFAKQY
FT                   KDKKDFQTEKDALISYLRMNQKRDGKATPLANNSLRHALNLAVDKKQLTDRILGDGSFP
FT                   ANGLLPKDFVQNPTTGADFRTDSGNHLVYNKEEALKYWKQAQKELGTDKVTIELLGDDQ
FT                   ETTKTIFAYLKAQFEDNLPGVTIKVKNMPSKSATQLTSDGNYDLSLAAWMPDFKDPWTY
FT                   SSLFLSDYFNNHMSYNSPAYDKLVKSTDTTLATKPEERWNAFVASEKVLLDDDAAILPL
FT                   YQHQTAVLQRTDITGVQKHAFGSPYSYKFIRVEK"
     MHFLKKTLPI FAILTVLLLT ACGNDNEKST TKTSPDKIKF LETSELLTLN TTAEEDFASF        60
     TAQNQVFEGL YTLDQKDNFV PGVADGMPEI STDQTKYTIK LKKNAKWSDG SQVTADDFVY       120
     AWRRAVDPKT APGYSALFKD SIKNATEINE GKLPVTDLGV VATDPTTLEI TLKKPVPYFI       180
     SLLSFETFFP QKESYVKKQG DKYGTDSAHT LYNGPFVMKD WGGNITNKWT YAKNDQYWDK       240
     DNVKVNEIDV QVAKDINAGV NLYNTNEADR VPLSGDFAKQ YKDKKDFQTE KDALISYLRM       300
     NQKRDGKATP LANNSLRHAL NLAVDKKQLT DRILGDGSFP ANGLLPKDFV QNPTTGADFR       360
     TDSGNHLVYN KEEALKYWKQ AQKELGTDKV TIELLGDDQE TTKTIFAYLK AQFEDNLPGV       420
     TIKVKNMPSK SATQLTSDGN YDLSLAAWMP DFKDPWTYSS LFLSDYFNNH MSYNSPAYDK       480
     LVKSTDTTLA TKPEERWNAF VASEKVLLDD DAAILPLYQH QTAVLQRTDI TGVQKHAFGS       540
     PYSYKFIRVE K                                                            551
//

If you have problems or comments...

PBIL Back to PBIL home page